KEGG   Homo sapiens (human): 100289279
Entry
100289279         CDS       T01001                                 

Gene name
CNTNAP3C
Definition
(RefSeq) contactin associated protein family member 3C
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Laminin_G_2 F5_F8_type_C Laminin_G_1 Laminin_G_3
Other DBs
NCBI-GeneID: 100289279
NCBI-ProteinID: XP_011543974
HGNC: 53878
Ensembl: ENSG00000283378
Vega: OTTHUMG00000191808
LinkDB
Position
9q12
AA seq 495 aa
MASVAWAVLKVLLLLPTQTWSPVGAGNPPDCDAPLASALPRSSFSSSSELSSSHGPGFSR
LNRRDGAGGWTPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNW
KQYRREESIWGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYK
SEVVYFDGQSALLYRLDKKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGK
LVFFLNSGNAKLPSTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGD
SSYLDLNFEISFGGIPTPGRSRAFRRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNV
SFSCPQPQTVPVTFLSSRSYLALPGNSGEDKVSVTFQFRTWNRAGHLLFGELRRGSGSFV
LFLKDGKLKLSLFQPGQSPRNVTAGAGLNDGQWHSVSFSAKWSHMNVVVDDDTAVQPLVA
VLIDSGDTYYFGESF
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggcttcagtggcctgggccgtcctcaaggtgctgctgcttctccccactcagacttgg
agccccgtgggagcaggaaatccacctgactgtgatgccccactggcctctgccttgcct
aggtcatccttcagcagctcctcagagctgtccagcagccacggcccggggttttcaagg
cttaatcgaagagatggagctggtggctggactccacttgtgtcaaataaataccaatgg
ctgcaaattgaccttggagagagaatggaggtcactgctgtcgccacccaaggaggatat
gggagctctgactgggtgaccagctacctcctgatgttcagtgatggtgggagaaactgg
aagcagtatcgccgagaagaaagcatctggggttttccaggaaacacaaacgcagacagt
gtggtgcactacagactccagcctccctttgaagccaggttcctgcgctttctcccttta
gcctggaaccctaggggcaggattgggatgcggatcgaagtgtacggatgtgcatataaa
tctgaggtggtttattttgatggacaaagtgctctgctgtatagacttgataaaaaacct
ttaaaaccaataagagacgttatttctttgaaatttaaagccatgcagagcaatggaatt
ctacttcacagagaaggacaacatggaaatcacattactctggaattaattaaaggaaag
cttgtcttttttcttaattcaggcaatgctaagctgccttccactattgctcctgtgacc
ctcaccctgggcagcctgctggacgaccagcactggcattccgtcctcatcgagctcctc
gacacgcaggtcaacttcaccgtggacaaacacactcatcatttccaagcaaagggagat
tccagttacttggatcttaattttgagatcagctttgggggaattccgacacccggaaga
tcgcgggcattcagacgtaaaagctttcatgggtgtttagaaaatctttattataatgga
gtggatgttaccgaattagccaagaaacacaaaccacagatcctcatgatgggaaatgtg
tccttctcatgtccacagccacagactgtccctgtgacttttctgagctccaggagttat
ctggctctgccaggcaactctggggaggacaaagtgtctgtcacttttcaatttcgaacg
tggaacagagcaggacatttgcttttcggcgaacttcgacgtggttcagggagtttcgtc
ctctttcttaaggatggcaagctcaaactgagtctcttccagccgggacagtcaccaagg
aatgtcacagcaggtgctggattaaacgatgggcagtggcactctgtgtccttctctgcc
aagtggagccatatgaatgtggtggtggacgatgacacagctgttcagcccctggtggct
gtgctcattgattcaggtgacacctattattttggagaatccttttaa

DBGET integrated database retrieval system