KEGG   Homo sapiens (human): 100310812Help
Entry
100310812         CDS       T01001                                 

Gene name
SPDYE2B, SPDYE2L
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E2B
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100310812 (SPDYE2B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100310812 (SPDYE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 100310812
NCBI-ProteinID: NP_001159811
HGNC: 48334
Ensembl: ENSG00000173678
Vega: OTTHUMG00000158393
Pharos: A6NHP3(Tdark)
UniProt: A6NHP3
LinkDB All DBs
Position
7q22.1
AA seq 402 aa AA seqDB search
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKPWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacggagactaggttccgtaagaggggacagattacgggaaagatcacgacc
agccgtcaaccgcacccccagaatgagcagagtccccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaaatgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcatccatcctccctgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcttggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggcttcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggactccaaacaaaacatcttccacttcctgtataggaagaaccgctctcgc
atacccttgctccgtaagccttggttccagttaggccattccatgaacccgagggccagg
aagaaccgctctcgcatacccttgctccgtaagcgtcggttccagttataccgttccacg
aacccgagggccaggaagaaccgctctcgcatacccttgctccgtaagcgtcggttccag
ttataccgttccatgaactcgagggccaggaagaaccgctctcagatagtcctgttccag
aaacgacggttccacttcttctgttccatgagctgcagggcttgggtttccccagaggag
ttggaggagatccaggcttatgacccagagcactgggtgtgggcgcgagatcgcgctcac
ctttcctag

KEGG   Homo sapiens (human): 100505767Help
Entry
100505767         CDS       T01001                                 

Gene name
SPDYE18
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E18
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100505767 (SPDYE18)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100505767 (SPDYE18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 100505767
NCBI-ProteinID: NP_001338277
HGNC: 51514
LinkDB All DBs
Position
7q11.23
AA seq 275 aa AA seqDB search
MDRTKTRFRKRGQITGKITTSRQPHPQNEQSLQRSTSGYPLQEVVDDEVLGPSAPGVDPS
PPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHK
DFNSQLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLAND
MEEDDEDPKQNIFYFLYGKTRSRIPLVRNRRFQLCRCLNPRARKNRSQIALFQKLRFQFF
CSMSGRAWVSREELEEIQAYDPEHWVWARDRARLS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacgaagactaggttccgtaagaggggacagattacgggaaagatcacgacc
agccgtcaaccgcacccccagaatgagcagagtctccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaagtgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagaaggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccctgagcaccacaag
gacttcaacagtcagcttgaggatcctgtcattaaaagattcctggcctgggacaaagat
ctgagggtgtcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggc
ctcccctcctggcaataccaacgcattcatttcttcctggctctctacctggccaatgac
atggaggaggacgacgaggaccccaaacaaaacatcttctacttcctgtatgggaagacc
cgctctcgcatacccttggtccgtaaccgtcggttccagttatgccgttgcttgaacccg
agggccaggaagaaccgctctcagatagccctgttccagaaacttcggttccagttcttc
tgttccatgagcggcagggcttgggtttcccgggaggagttggaggagatccaggcttat
gacccagagcactgggtgtgggcgcgagatcgcgctcgcctttcctag

KEGG   Homo sapiens (human): 100996746Help
Entry
100996746         CDS       T01001                                 

Gene name
SPDYE11
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E11
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100996746 (SPDYE11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100996746 (SPDYE11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 100996746
NCBI-ProteinID: NP_001338278
HGNC: 51507
Ensembl: ENSG00000286228
LinkDB All DBs
Position
7q11.23
AA seq 265 aa AA seqDB search
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattttgggaaagatcatgatgagccatcaaccgcagccccaggaagagcgg
agcccccagcggagcacctcagggtaccccctccaggaggtggtggatgatgaagtgtcg
ggaccatcagcccctggggtagatcccagccccccacgtaggtcccttggctggaaaagg
aagagggaatgtttggatgaatctgatgatgagccagagaaggagctcgcccctgagcct
gaggagacctgggtggcggagacgctgtgtggcctcaagatgaaggcgaagcgacggcga
gtgtcgctcgtgctccctgagtactacgaggccttcaacaggctgcttgaggatcctgtc
attaaaagactcctggcctgggacaaagatctgagggtgtcggacaagtatctcctggct
atggtcatagcgtatttcagccgggccggcctcccctcctggcaataccaacgcattcat
ttcttcctggctctctatctggccaatgacatggaggaggacgacgaggcccccaaacaa
aacatcttctacttcctgtacgaggagacccgctctcatatacccttgctcagtgagctt
tggttccagttatgccgttacatgaacccgagggccaggaagaactgctctcagatagcc
ttgttccggaagtatcggttccacttcttttgttccatgcgctgcagggcttgggtttcc
ctggaggagttggaagagatccaggcttatgacccagagcactgggtgtgggcgcgagat
cgcgcccacctttcctag

KEGG   Homo sapiens (human): 102723555Help
Entry
102723555         CDS       T01001                                 

Gene name
SPDYE16
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E16
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102723555 (SPDYE16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102723555 (SPDYE16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 102723555
NCBI-ProteinID: NP_001338526
HGNC: 51512
Ensembl: ENSG00000185040
Vega: OTTHUMG00000155814
Pharos: A6NNV3(Tdark)
LinkDB All DBs
Position
7q11.23
AA seq 312 aa AA seqDB search
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLC
GLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPR
KVLAPEPEEIWVVEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRV
SDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSR
IPLVRNRRFQLCRCMNPRARKNRSQIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPE
HWVWARDRARLS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcattacacggtggcctggtttctttactcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagaaggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccctgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagagggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggtggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcctggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggcctcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggaccccaaacaaaacatcttctacttcctgtatgggaagacccgctctcgc
atacccttggtccgtaaccgtcggttccagttatgccgttgcatgaacccgagggccagg
aagaaccgctctcagatagccctgttccagaaacttcggttccagttcttctgttccatg
agcggcagggcttgggtttcccgggaggagttggaggagatccaggcttatgacccagag
cactgggtgtgggcgcgagatcgcgctcgcctttcctag

KEGG   Homo sapiens (human): 102723849Help
Entry
102723849         CDS       T01001                                 

Gene name
SPDYE17
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E17
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102723849 (SPDYE17)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102723849 (SPDYE17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 102723849
NCBI-ProteinID: NP_001338280
HGNC: 51513
LinkDB All DBs
Position
7q11.23
AA seq 265 aa AA seqDB search
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattttgggaaagatcatgatgagccatcaaccgcagccccaggaagagcgg
agcccccagcggagcacctcagggtaccccctccaggaggtggtggatgatgaagtgtcg
ggaccatcagcccctggggtagatcccagccccccacgtaggtcccttggctggaaaagg
aagagggaatgtttggatgaatctgatgatgagccagagaaggagctcgcccctgagcct
gaggagacctgggtggcggagacgctgtgtggcctcaagatgaaggcgaagcgacggcga
gtgtcgctcgtgctccctgagtactacgaggccttcaacaggctgcttgaggatcctgtc
attaaaagactcctggcctgggacaaagatctgagggtgtcggacaagtatctcctggct
atggtcatagcgtatttcagccgggccggcctcccctcctggcaataccaacgcattcat
ttcttcctggctctctatctggccaatgacatggaggaggacgacgaggcccccaaacaa
aacatcttctacttcctgtacgaggagacccgctctcatatacccttgctcagtgagctt
tggttccagttatgccgttacatgaacccgagggccaggaagaactgctctcagatagcc
ttgttccggaagtatcggttccacttcttttgttccatgcgctgcagggcttgggtttcc
ctggaggagttggaagagatccaggcttatgacccagagcactgggtgtgggcgcgagat
cgcgcccacctttcctag

KEGG   Homo sapiens (human): 245711Help
Entry
245711            CDS       T01001                                 

Gene name
SPDYA, RINGO3, RINGOA, SPDY1, SPY1
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member A
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    245711 (SPDYA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    245711 (SPDYA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 245711
NCBI-ProteinID: NP_001136106
OMIM: 614029
HGNC: 30613
Ensembl: ENSG00000163806
Vega: OTTHUMG00000074041
Pharos: Q5MJ70(Tbio)
UniProt: Q5MJ70 A0A384MTT5
LinkDB All DBs
Structure
PDB: 

Position
2p23.2
AA seq 313 aa AA seqDB search
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
KDKSMEWFTGSEE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacaatcagatgtgttgtgagacaccacctactgtcactgtttatgtaaaatca
gggtcaaatagatcacatcagcctaaaaagcccattactctgaagcgtcctatttgtaaa
gataattggcaagcatttgaaaaaaatacacataataacaacaaatctaaacgccccaaa
ggaccttgtctggttatacagcgtcaggatatgactgctttctttaaattatttgatgac
gatttaattcaagatttcttgtggatggactgctgctgtaaaattgcagacaagtatctt
ttggctatgacctttgtttatttcaagagggctaaatttactataagtgagcataccagg
ataaatttctttattgctctgtatctggctaatacagttgaagaagatgaagaagaaacc
aagtacgaaatttttccatgggctttagggaaaaactggagaaaattgttccctaatttc
ttaaagttaagggaccagctctgggatagaattgactatagggctattgtaagcaggcga
tgttgtgaggaggttatggccattgcaccaacccattatatctggcaaagagaacgttct
gttcatcacagtggagctgtcagaaactacaacagagatgaagttcagctgccccgggga
cctagtgccacaccagtagattgttcactctgtggtaaaaaaagaagatatgttagactg
ggattgtcttcatcatcatctttatccagtcatacagcaggggtgacagaaaaacattct
caggactcatacaactcactgtcaatggacataataggtgatccttctcaagcttatact
ggttctgaagtagtcaatgaccatcaatcaaataaaggaaagaaaactaatttcttgaag
aaagacaaatctatggagtggtttacaggaagtgaagaatga

KEGG   Homo sapiens (human): 285955Help
Entry
285955            CDS       T01001                                 

Gene name
SPDYE1, Ringo1, SPDYB2L2, SPDYE, WBSCR19
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E1
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    285955 (SPDYE1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    285955 (SPDYE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 285955
NCBI-ProteinID: NP_778234
OMIM: 617623
HGNC: 16408
Ensembl: ENSG00000136206
Vega: OTTHUMG00000128985
Pharos: Q8NFV5(Tdark)
UniProt: Q8NFV5
LinkDB All DBs
Position
7p13
AA seq 336 aa AA seqDB search
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLC
GLKMKLKQQRVSPILLEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRK
VLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVS
DKYLLAMVIAYFSRAGFPSWQYQRLHFFLALYLANDMEEDDEDSKQNIFHFLYGKNRSRI
PLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMNPRARKNRSQIVLFQKRRFHF
FCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcattacacagtggcctggtttctttactcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagacgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccttgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacaaatctgaggagtcggaggaggagccacggaag
gtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaagatg
aagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaacagg
ctgcttgaggatcctgtcattaaaagattcctggcctgggacaaagatctgagggtgtcg
gacaagtatctccttgctatggtcatagcgtatttcagccgagccggcttcccctcctgg
caataccaacgccttcatttcttcctggctctctacctggccaatgacatggaggaggac
gacgaggactccaaacaaaacatcttccacttcctgtatgggaagaaccgctctcgcata
cccttgctccgtaagcgtcggttccagttataccgttccatgaacccgagggccaggaag
aaccgctctcacatacccttggtccgtaagcgtcggttccagttacgccgttgcatgaac
ccgagggccaggaagaaccgctctcagatagtcctgttccagaaacgtcggttccacttc
ttctgttccatgagctgcagggcttgggtttccccagaggagttggaggagatccaggct
tatgacccagagcactgggtgtgggcgcgagatcgcgctcgcctttcctag

KEGG   Homo sapiens (human): 387778Help
Entry
387778            CDS       T01001                                 

Gene name
SPDYC, RINGOC, Ringo2
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member C
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    387778 (SPDYC)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    387778 (SPDYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 387778
NCBI-ProteinID: NP_001008778
OMIM: 614030
HGNC: 32681
Ensembl: ENSG00000204710
Vega: OTTHUMG00000165611
Pharos: Q5MJ68(Tdark)
UniProt: Q5MJ68
LinkDB All DBs
Position
11q13.1
AA seq 293 aa AA seqDB search
MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQ
AFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLAND
MEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFH
WAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSL
TSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggccattcctgagctcgggtcaccctgccccatctccatctcctatgagatg
agtgactcccaagaccccaccacttcccctgtagttaccacccaggtagagctggggggc
tgcagccggcaaggtgggggcaatgggttcctccgttttcgccagcaccaggaggtccag
gccttcctcagccttctggaggacagttttgtccaggaattcctctccaaagacccctgc
ttccagatttcagataagtatctcctggccatggtgctggtctacttccagcgcgcccac
ctgaagctcagcgagtatacccacagcagcctgttcttggccctgtaccttgcaaacgac
atggaggaggacctggagggccccaaatgtgagatttttccatgggccctgggaaaagat
tggtgtttacgagtggggaaattcctgcaccagagggataagctttgggcacggatgggt
ttccgggctgttgtgagccgccagtgctgtgaggaggtcatggcaaaggagccattccac
tgggcttggactcgggaccggcgcccccaccatggtggggttcagagggtctgtccacag
gtccctgttcgccttccccggggccctggcctctcgccgccccactgttccccctgtggt
ttgccccagcactgcagcagccacttgcttaagcctgtgtcatccaagtgcccttctctg
acctctgaatgtcatcgccctccctcccaaaattatctctcaagggtcaaaaacgcctgg
ggtggggactttctcatcgtcttgcctccccagatgcaactggaaccaggcacctactcc
ctccgcatcttcccaaagcctccggcacgccctgggcactga

KEGG   Homo sapiens (human): 388333Help
Entry
388333            CDS       T01001                                 

Gene name
SPDYE4
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E4
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    388333 (SPDYE4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    388333 (SPDYE4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 388333
NCBI-ProteinID: NP_001121548
OMIM: 617628
HGNC: 35463
Ensembl: ENSG00000183318
Vega: OTTHUMG00000178566
Pharos: A6NLX3(Tdark)
UniProt: A6NLX3
LinkDB All DBs
Position
17p13.1
AA seq 237 aa AA seqDB search
MASGQARPPFEEESPQPSTTVRSPEVVVDDEVPGPSAPWIDPSPQPQSLGLKRKSEWSDE
SEEELEEELELERAPEPEDTWVVETLCGLKMKLKRKRASSVLPEHHEAFNRLLGDPVVQK
FLAWDKDLRVSDKYLLAMVIAYFSRAGLFSWQYQRIHFFLALYLASDMEEDNQAPKQDIF
SFLYGKNYSQRPLFHKLRYQLLCSMRWRTWVSPEEMEEIQAYDPEHWVWARDRTLIS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggccagtggtcaagcgcgccccccgtttgaggaggagagcccccagcctagcacaacg
gtacggtcccccgaggtggtggtggatgatgaagtgccaggaccatcagccccttggata
gatcccagcccccagcctcaatcccttggcctgaaaaggaagagcgaatggtcagacgaa
tccgaggaggagctggaggaggagctggagttggagcgcgcccctgagcccgaggacacc
tgggtggtggagacgctgtgtgggctcaagatgaagctgaagcgaaagcgagcatcctcc
gtgctccctgagcaccacgaggccttcaacaggctccttggggatcctgtcgttcaaaaa
ttcctggcctgggacaaagacctgagggtgtcagacaagtatctcctggctatggtcata
gcgtattttagccgtgccggcctcttctcgtggcaataccaacgcattcatttcttcctg
gctctctacctggccagtgacatggaggaggacaaccaggccccgaaacaagacatcttc
tccttcctctacgggaagaactactcccagcgacccttgttccataagcttcgataccag
ctcctctgttccatgcgctggaggacgtgggtttccccagaggagatggaggagatccag
gcttatgacccagagcactgggtgtgggcccgagatcgcaccctcatttcctag

KEGG   Homo sapiens (human): 441272Help
Entry
441272            CDS       T01001                                 

Gene name
SPDYE3, SPDYB2
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E3
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    441272 (SPDYE3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    441272 (SPDYE3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 441272
NCBI-ProteinID: NP_001004351
OMIM: 617625
HGNC: 35462
Ensembl: ENSG00000214300
Vega: OTTHUMG00000155462
Pharos: A6NKU9(Tdark)
UniProt: A6NKU9
LinkDB All DBs
Position
7q22.1
AA seq 549 aa AA seqDB search
MTSHQPQPQEEQSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGCKRKRECLDES
DDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLAPGVDPSPPRRS
LGCKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRL
LAPGVDPSPPRRSLGCKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVS
LVLPEYYEAFNRLLAPGVDPSPPRRSLGCKRKRECLDESDDEPEKELAPEPEETWVAETL
CGLKMKAKRRRVSLVLPEYYEAFNRLLAPGVDPSPPRRSLGCKRKRECLDESDDEPEKEL
APEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRFLAWDKDLRVSDK
YLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQKIFYFLYGKTHSHIPL
RPKHWFQLCRPMNPRARKNCSQIALFQKRRFQFFCSMRCRAWVSPEELEEIQAYDPEHWV
WARDRAHLS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccatcaaccgcagccccaggaagagcagagcccccagcggagcacctcaggg
taccccctccaggaggtggtggatgatgaagtgtcgggaccatcagcccctggggtagat
cccagccccccacgtaggtcccttggctgcaaaaggaagagggagtgtttggatgaatct
gatgatgagccagagaaggagctcgcccctgagcctgaggagacctgggtggcggagacg
ctgtgtggcctcaagatgaaggcgaagcgacggcgagtgtcgctcgtgctccctgagtac
tacgaggccttcaacaggctgcttgcccctggggtagatcccagccccccacgtaggtcc
cttggctgcaaaaggaagagggagtgtttggatgaatctgatgatgagccagagaaggag
ctcgcccctgagcctgaggagacctgggtggcggagacgctgtgtggcctcaagatgaag
gcgaagcgacggcgagtgtcgctcgtgctccctgagtactacgaggccttcaacaggctg
cttgcccctggggtagatcccagccccccacgtaggtcccttggctgcaaaaggaagagg
gagtgtttggatgaatctgatgatgagccagagaaggagctcgcccctgagcctgaggag
acctgggtggcagagacgctgtgtggcctcaagatgaaggcgaagcgacggcgagtgtcg
ctcgtgctccctgagtactacgaggccttcaacaggctgcttgcccctggggtagatccc
agccccccacgtaggtcccttggctgcaaaaggaagagggagtgtttggatgaatctgat
gatgagccagagaaggagctcgcccctgagcctgaggagacctgggtggcggagacgctg
tgtggcctcaagatgaaggcgaagcgacggcgagtgtcgctcgtgctccctgagtactac
gaggccttcaacaggctgcttgcccctggggtagatcccagccccccgcgtaggtccctt
ggctgcaaaaggaagagggagtgtttggatgaatctgatgatgagccagagaaggagctc
gcccctgagcctgaggagacctgggtggcggagacgctgtgtggcctcaagatgaaggcg
aagcgacggcgagtgtcgctcgtgctccctgagtactacgaggccttcaacaggctgctt
gaggatcctgtcattaaaagattcctggcctgggacaaagatctgagggtgtcagacaag
tatctcctggctatggtcatagcgtatttcagccgggccggcctcccctcctggcaatac
caacgcattcatttcttcctggctctctatctggccaatgacatggaggaggacgacgag
gcccccaaacaaaagatcttctacttcctgtacgggaagacccactctcacatacccttg
cgccctaagcattggttccagttatgccgtcccatgaacccgagggccaggaagaactgc
tctcagatagccttgttccagaagcgtcggttccagttcttctgttccatgcgctgcagg
gcttgggtttccccggaggagttggaggagatccaggcttatgacccagagcactgggtg
tgggcgcgagatcgcgcccacctttcctag

KEGG   Homo sapiens (human): 441273Help
Entry
441273            CDS       T01001                                 

Gene name
SPDYE2, SPDYB2-L1, SPDYB2L1
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E2
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    441273 (SPDYE2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    441273 (SPDYE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 441273
NCBI-ProteinID: NP_001026789
OMIM: 617624
HGNC: 33841
Ensembl: ENSG00000205238
Vega: OTTHUMG00000150385
Pharos: Q495Y8(Tdark)
UniProt: Q495Y8 I6XC90
LinkDB All DBs
Position
7q22.1
AA seq 402 aa AA seqDB search
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKPWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacggagactaggttccgtaagaggggacagattacgggaaagatcacgacc
agccgtcaaccgcacccccagaatgagcagagtccccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaaatgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccctgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcttggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggcttcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggactccaaacaaaacatcttccacttcctgtataggaagaaccgctctcgc
atacccttgctccgtaagccttggttccagttaggccattccatgaacccgagggccagg
aagaaccgctctcgcatacccttgctccgtaagcgtcggttccagttataccgttccacg
aacccgagggccaggaagaaccgctctcgcatacccttgctccgtaagcgtcggttccag
ttataccgttccatgaactcgagggccaggaagaaccgctctcagatagtcctgttccag
aaacgacggttccacttcttctgttccatgagctgcagggcttgggtttccccagaggag
ttggaggagatccaggcttatgacccagagcactgggtgtgggcgcgagatcgcgctcac
ctttcctag

KEGG   Homo sapiens (human): 442590Help
Entry
442590            CDS       T01001                                 

Gene name
SPDYE5
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E5
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    442590 (SPDYE5)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    442590 (SPDYE5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 442590
NCBI-ProteinID: NP_001293070
HGNC: 35464
Ensembl: ENSG00000170092
Vega: OTTHUMG00000156138
UniProt: A6NIY4
LinkDB All DBs
Position
7q11.23
AA seq 402 aa AA seqDB search
MDRTETRFRKRGQITEKITTSRQPQPQNEQSPQRSTSGYPLQEVVDDEVLGPSAPGVDPS
PPCRSLGWKRKREWSDESAEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHK
GFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYGKNRSRIPLLRKRWFQLGRSMNPRAR
KKRSRIPLLRKRRFQLGRSMNPRARKNRSRIPLLRKRRFQLGRSMNLRARKNRSQIVLFQ
KRRFQFFCSMSGRAWVSPEELEEIQAYDPEHWVWARDRAHLS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacggagactaggttccgtaagaggggacagattacggaaaagatcacgacc
agccgtcaaccgcaaccccagaatgagcagagtccccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaagtgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgcggag
gagccggagaaggagctcgcccctgaacctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccctgagcaccacaag
ggcttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcctggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggcttcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggactccaaacaaaacatcttccacttcctgtatgggaagaaccgctctcgc
atacccttgctccgtaagcgttggttccagttaggccgttccatgaacccgagggccagg
aagaagcgctctcgcatacccttgctccgtaagcgtcggttccagttaggccgttccatg
aacccgagggccaggaagaaccgctctcgcatacccttgctccgtaagcgtcggttccag
ttaggccgttccatgaacctgagggccaggaagaaccgctctcagatagtcctgttccag
aaacgtcggttccagttcttctgttccatgagcggcagggcttgggtttccccggaggag
ttggaggagatccaggcttatgacccagagcactgggtgtgggcgcgagatcgcgctcac
ctttcctag

KEGG   Homo sapiens (human): 729597Help
Entry
729597            CDS       T01001                                 

Gene name
SPDYE6
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E6
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    729597 (SPDYE6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    729597 (SPDYE6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 729597
NCBI-ProteinID: NP_001139682
HGNC: 35465
Ensembl: ENSG00000260097
Vega: OTTHUMG00000157126
UniProt: P0CI01
LinkDB All DBs
Position
7q22.1
AA seq 402 aa AA seqDB search
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKHRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacggagactaggttccgtaagaggggacagattacgggaaagatcacgacc
agccgtcaaccgcacccccagaatgagcagagtccccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaaatgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcatccatcctccctgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcttggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggctggcttcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggactccaaacaaaacatcttccacttcctgtataggaagaaccgctctcgc
atacccttgctccgtaagcgttggttccagttaggccattccatgaacccgagggccagg
aagaaccgctctcgcatacccttgctccgtaagcgtcggttccagttataccgttccacg
aacccgagggccaggaagaaccgctctcgcatacccttgctccgtaagcatcggttccag
ttataccgttccatgaactcgagggccaggaagaaccgctctcagatagtcctgttccag
aaacgacggttccacttcttctgttccatgagctgcagggcttgggtttccccagaggag
ttggaggagatccaggcttatgacccagagcactgggtgtgggcgcgagatcgcgctcac
ctttcctag

DBGET integrated database retrieval system