KEGG   Homo sapiens (human): 100509620
Entry
100509620         CDS       T01001                                 

Definition
(RefSeq) putative aquaporin-7-like protein 3
  KO
K08771  aquaporin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100509620
   03320 PPAR signaling pathway
    100509620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    100509620
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    100509620
SSDB
Motif
Pfam: MIP aGPT-Pplase1
Other DBs
NCBI-GeneID: 100509620
NCBI-ProteinID: NP_001369426
Ensembl: ENSG00000259916
Vega: OTTHUMG00000175552
LinkDB
Position
2q11.1
AA seq 346 aa
MVQASGHRRSTRGSKMVSWSVIAKIQEIWCEEDERKMVREFLAEFMSTYVMMVFGLGSVA
HMVLNKTYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFTNCALGRVPWRKFPVHV
LGQFLGSFLAAATIYSLFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWRGFLNEE
WLTRMLQLCLFTITDQENNPALPGTHALVISILVVIIRVSHGINTGYAINPSRDPPPSIF
TFIAGWGKQVFSDGENWWWVPVVAPLLGASLGGIIYLVFIGSTIPREPLKLEDSVAYEDH
GITVLPKMGSHEPMISPLTLISVSLANRSSVHSAPPLHESMALEHF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggttcaagcatctgggcacaggcggtccacccgtggctccaaaatggtctcctggtcc
gtgatagcaaagatccaggaaatatggtgcgaggaagatgagaggaagatggtgcgagag
ttcttggccgagttcatgagcacatatgtcatgatggtattcggccttggttctgtggcc
catatggttctaaataaaacatatgggagctaccttggtgtcaacttgggttttggcttc
ggggtcaccatgggagtccacgtggcaggccgcatctctggagcccacatgaatgcagct
gtgaccttcactaactgtgcgctgggccgcgtgccctggaggaagtttccagtccatgtg
ctggggcagttcctgggctccttcctggcagctgccaccatctacagtctcttctacacg
gccattctccacttttcgggtggagagctgatggtgaccggtccctttgctacagctggc
atttttgccacctaccttcctgatcacatgacattgtggcggggcttcctgaatgaggag
tggctgaccaggatgctccagctgtgtctcttcaccatcacggaccaggagaacaaccca
gcactgccaggaacacacgcgctggtgataagcatcctcgtggtcatcatcagggtgtcc
catggcataaacacaggatatgccatcaatccatcccgggacccgccccccagcatcttc
accttcattgctggctggggcaaacaggtcttcagcgatggggagaactggtggtgggtg
ccagtggtggcaccacttctgggtgcctctctaggtggcatcatctacctggtcttcatt
ggctccaccatcccacgggagcccctgaaattggaggactctgtggcgtatgaagaccac
gggataaccgtattgcccaagatgggatctcatgaacccatgatctctcccctcaccctc
atctccgtgagccttgccaacagatcttcagtccactctgccccacccttacatgaatcc
atggccctagagcacttctaa

KEGG   Homo sapiens (human): 112267859
Entry
112267859         CDS       T01001                                 

Definition
(RefSeq) putative aquaporin-7-like protein 3
  KO
K08771  aquaporin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    112267859
   03320 PPAR signaling pathway
    112267859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    112267859
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    112267859
SSDB
Motif
Pfam: MIP aGPT-Pplase1
Other DBs
NCBI-GeneID: 112267859
NCBI-ProteinID: XP_024303497
Ensembl: ENSG00000279688
LinkDB
Position
9q21.11
AA seq 310 aa
MAREFLAEFMSTYVMMVFGLGSVAHMLLNKTFGSYLGVNLGFGFGVTMGVHMAGRTSGAH
MNAAVSLTNCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGELMVTGPV
ATVGIFATYLPDHMTLWRGFLNEEWLTGMLQLCLFAIVDQENNPALPGTHALVIGILVVI
IRVYHGMNTGYAINPSRDLPPRIFTFIAGWGKLVFSDGENLWWVPVVAPLLGASLGGIIY
LVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPMISPLTLISVSPANRSSVHPAPP
LHESMALEHF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcgcgagagttcctggccgagttcatgagcacatatgtcatgatggtattcggcctt
ggttccgtggcccatatgcttctaaataaaacatttgggagctaccttggtgtcaacttg
ggttttggcttcggagtcaccatgggagtgcacatggcaggccgcacctctggagcccac
atgaacgcagctgtgagcctcactaactgtgcactgggccgtgtgccctggaggaagttt
ccagtctatgtgctggggcagttcctgggctccttcctggcagctgccaccatctacagt
ctcttctacacggccattctccacttttcgggtggagagctgatggtgaccggtcccgtt
gctacagttggcatttttgccacctaccttcctgatcacatgacattgtggcggggcttc
ctgaatgaggagtggctgaccgggatgctccagctgtgtctcttcgccatcgtggaccag
gagaacaacccagcactgccaggaacacacgcactggtgataggcatcctcgtggtcatc
atcagggtgtaccatggcatgaacacaggatatgccatcaatccgtcccgggacctgccc
ccccgcatcttcaccttcattgctggttggggcaaactggtcttcagcgatggggagaac
ttgtggtgggtgccagtggtggcaccacttctgggtgcctctctaggtggcatcatctac
ctggtcttcattggctccaccatcccacgggagcccctgaaattggaggactctgtggca
tatgaagaccacgggataaccgtattgcccaagatgggatctcatgaacccatgatctct
ccccttaccctcatctccgtgagccctgccaacagatcttcagtccaccctgccccaccc
ttacatgaatccatggccctagagcacttctaa

KEGG   Homo sapiens (human): 364
Entry
364               CDS       T01001                                 

Gene name
AQP7, AQP7L, AQPap, GLYCQTL
Definition
(RefSeq) aquaporin 7
  KO
K08771  aquaporin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    364 (AQP7)
   03320 PPAR signaling pathway
    364 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    364 (AQP7)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    364 (AQP7)
SSDB
Motif
Pfam: MIP aGPT-Pplase1 PNTB
Other DBs
NCBI-GeneID: 364
NCBI-ProteinID: NP_001161
OMIM: 602974
HGNC: 640
Ensembl: ENSG00000165269
Vega: OTTHUMG00000019773
Pharos: O14520(Tbio)
UniProt: O14520
LinkDB
Position
9p13.3
AA seq 342 aa
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVL
NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQF
LGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTG
MLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIA
GWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITV
LPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggttcaagcatccgggcacaggcggtccacccgtggctccaaaatggtctcctggtcc
gtgatagcaaagatccaggaaatactgcagaggaagatggtgcgagagttcctggccgag
ttcatgagcacatatgtcatgatggtattcggccttggttccgtggcccatatggttcta
aataaaaaatatgggagctaccttggtgtcaacttgggttttggcttcggagtcaccatg
ggagtgcacgtggcaggccgcatctctggagcccacatgaacgcagctgtgacctttgct
aactgtgcgctgggccgcgtgccctggaggaagtttccggtctatgtgctggggcagttc
ctgggctccttcctggcggctgccaccatctacagtctcttctacacggccattctccac
ttttcgggtggacagctgatggtgaccggtcccgtcgctacagctggcatttttgccacc
taccttcctgatcacatgacattgtggcggggcttcctgaatgaggcgtggctgaccggg
atgctccagctgtgtctcttcgccatcacggaccaggagaacaacccagcactgccagga
acagaggcgctggtgataggcatcctcgtggtcatcatcggggtgtcccttggcatgaac
acaggatatgccatcaacccgtcccgggacctgcccccccgcatcttcaccttcattgct
ggttggggcaaacaggtcttcagcaatggggagaactggtggtgggtgccagtggtggca
ccacttctgggtgcctatctaggtggcatcatctacctggtcttcattggctccaccatc
ccacgggagcccctgaaattggaggattctgtggcgtatgaagaccacgggataaccgta
ttgcccaagatgggatctcatgaacccacgatctctcccctcacccccgtctctgtgagc
cctgccaacagatcttcagtccaccctgccccacccttacatgaatccatggccctagag
cacttctaa

DBGET integrated database retrieval system