KEGG   Homo sapiens (human): 100996758
Entry
100996758         CDS       T01001                                 

Gene name
NPY4R2, CH17-360D5.1, NPY4-R, NPY4R, PP1, PPYR1
Definition
(RefSeq) neuropeptide Y receptor Y4-2
  KO
K04206  neuropeptide Y receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100996758 (NPY4R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    100996758 (NPY4R2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    100996758 (NPY4R2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF2298 Piezo_RRas_bdg DUF4790 PsbW CD225
Other DBs
NCBI-GeneID: 100996758
NCBI-ProteinID: NP_001265724
HGNC: 52383
Ensembl: ENSG00000264717
Vega: OTTHUMG00000188323
UniProt: P0DQD5 P50391
LinkDB
Position
10q11.22
AA seq 375 aa
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL
CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI
QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL
ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRR
LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG
NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
VSKGSLRLSGRSNPI
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaacacctctcacctcctggccttgctgctcccaaaatctccacaaggtgaaaacaga
agcaaacccctgggcaccccatacaacttctctgaacattgccaggattccgtggacgtg
atggtcttcattgtcacttcctacagcattgagactgtcgtgggggtcctgggtaacctc
tgcctgatgtgtgtaactgtgaggcagaaggagaaagccaacgtgaccaacctgcttatc
gccaacctggccttctctgacttcctcatgtgcctcctctgccagccgctgaccgccgtc
tacaccatcatggactactggatctttggagagaccctctgcaagatgtcggccttcatc
cagtgcatgtcggtgacggtctccatcctctcgctcgtcctcgtggccctggagaggcat
cagctcatcatcaacccaacaggctggaagcccagcatctcacaggcctacctggggatt
gtgctcatctgggtcattgcctgtgtcctctccctgcccttcctggccaacagcatcctg
gagaatgtcttccacaagaaccactccaaggctctggagttcctggcggataaggtggtc
tgtaccgagtcctggccactggctcaccaccgcaccatctacaccaccttcctgctcctc
ttccagtactgcctcccactgggcttcatcttggtctgttatgcacgcatctaccggcgc
ctgcagaggcaggggcgcgtgtttcacaagggcacctacagcttgcgagctgggcacatg
aagcaggtcaatgtggtgctggtggtgatggtggtggcctttgccgtgctctggctgcct
ctgcatgtgttcaacagcctggaagactggcaccatgaggccatccccatctgccatggg
aacctcatcttcttagtgtgccacttgcttgccatggcctccacctgtgtcaacccattc
atctatggctttctcaacaccaacttcaagaaggagatcaaggccctggtgctgacttgc
cagcagagcgcccccctggaggagtcagagcatctgcccctgtccacagtacatacggaa
gtctccaaagggtccctgaggctaagtggcaggtccaatcccatttaa

KEGG   Homo sapiens (human): 10888
Entry
10888             CDS       T01001                                 

Gene name
GPR83, GIR, GPR72
Definition
(RefSeq) G protein-coupled receptor 83
  KO
K04210  G protein-coupled receptor 83
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10888 (GPR83)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10888 (GPR83)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10888 (GPR83)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    10888 (GPR83)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 10888
NCBI-ProteinID: NP_057624
OMIM: 605569
HGNC: 4523
Ensembl: ENSG00000123901
Vega: OTTHUMG00000167779
Pharos: Q9NYM4(Tbio)
UniProt: Q9NYM4
LinkDB
Position
11q21
AA seq 423 aa
MVPHLLLLCLLPLVRATEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRR
YGAESQNPTVKALLIVAYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMI
TLLNTPFTLVRFVNSTWIFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPR
ISITKGVIYIAVIWTMATFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLD
LATFILLYILPLLIISVAYARVAKKLWLCNMIGDVTTEQYFALRRKKKKTIKMLMLVVVL
FALCWFPLNCYVLLLSSKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALL
SMCQRPPKPQEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIV
TMS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggtccctcacctcttgctgctctgtctcctccccttggtgcgagccaccgagccccac
gagggccgggccgacgagcagagcgcggaggcggccctggccgtgcccaatgcctcgcac
ttcttctcttggaacaactacaccttctccgactggcagaactttgtgggcaggaggcgc
tacggcgctgagtcccagaaccccacggtgaaagccctgctcattgtggcttactccttc
atcattgtcttctcactctttggcaacgtcctggtctgtcatgtcatcttcaagaaccag
cgaatgcactcggccaccagcctcttcatcgtcaacctggcagttgccgacataatgatc
acgctgctcaacacccccttcactttggttcgctttgtgaacagcacatggatatttggg
aagggcatgtgccatgtcagccgctttgcccagtactgctcactgcacgtctcagcactg
acactgacagccattgcggtggatcgccaccaggtcatcatgcaccccttgaaaccccgg
atctcaatcacaaagggtgtcatctacatcgctgtcatctggaccatggctacgttcttt
tcactcccacatgctatctgccagaaattatttaccttcaaatacagtgaggacattgtg
cgctccctctgcctgccagacttccctgagccagctgacctcttctggaagtacctggac
ttggccaccttcatcctgctctacatcctgcccctcctcatcatctctgtggcctacgct
cgtgtggccaagaaactgtggctgtgtaatatgattggcgatgtgaccacagagcagtac
tttgccctgcggcgcaaaaagaagaagaccatcaagatgttgatgctggtggtagtcctc
tttgccctctgctggttccccctcaactgctacgtcctcctcctgtccagcaaggtcatc
cgcaccaacaatgccctctactttgccttccactggtttgccatgagcagcacctgctat
aaccccttcatatactgctggctgaacgagaacttcaggattgagctaaaggcattactg
agcatgtgtcaaagacctcccaagcctcaggaggacaggccaccctccccagttccttcc
ttcagggtggcctggacagagaagaatgatggccagagggctccccttgccaataacctc
ctgcccacctcccaactccagtctgggaagacagacctgtcatctgtggaacccattgtg
acgatgagttag

KEGG   Homo sapiens (human): 4886
Entry
4886              CDS       T01001                                 

Gene name
NPY1R, NPY1-R, NPYR
Definition
(RefSeq) neuropeptide Y receptor Y1
  KO
K04204  neuropeptide Y receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4886 (NPY1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4886 (NPY1R)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4886 (NPY1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4886 (NPY1R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    4886 (NPY1R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx Git3
Other DBs
NCBI-GeneID: 4886
NCBI-ProteinID: NP_000900
OMIM: 162641
HGNC: 7956
Ensembl: ENSG00000164128
Vega: OTTHUMG00000161371
Pharos: P25929(Tchem)
UniProt: P25929
LinkDB
Position
4q32.2
AA seq 384 aa
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaattcaacattattttcccaggttgaaaatcattcagtccactctaatttctcagag
aagaatgcccagcttctggcttttgaaaatgatgattgtcatctgcccttggccatgata
tttaccttagctcttgcttatggagctgtgatcattcttggtgtctctggaaacctggcc
ttgatcataatcatcttgaaacaaaaggagatgagaaatgttaccaacatcctgattgtg
aacctttccttctcagacttgcttgttgccatcatgtgtctcccctttacatttgtctac
acattaatggaccactgggtctttggtgaggcgatgtgtaagttgaatccttttgtgcaa
tgtgtttcaatcactgtgtccattttctctctggttctcattgctgtggaacgacatcag
ctgataatcaaccctcgagggtggagaccaaataatagacatgcttatgtaggtattgct
gtgatttgggtccttgctgtggcttcttctttgcctttcctgatctaccaagtaatgact
gatgagccgttccaaaatgtaacacttgatgcgtacaaagacaaatacgtgtgctttgat
caatttccatcggactctcataggttgtcttataccactctcctcttggtgctgcagtat
tttggtccactttgttttatatttatttgctacttcaagatatatatacgcctaaaaagg
agaaacaacatgatggacaagatgagagacaataagtacaggtccagtgaaaccaaaaga
atcaatatcatgctgctctccattgtggtagcatttgcagtctgctggctccctcttacc
atctttaacactgtgtttgattggaatcatcagatcattgctacctgcaaccacaatctg
ttattcctgctctgccacctcacagcaatgatatccacttgtgtcaaccccatattttat
gggttcctgaacaaaaacttccagagagacttgcagttcttcttcaacttttgtgatttc
cggtctcgggatgatgattatgaaacaatagccatgtccacgatgcacacagatgtttcc
aaaacttctttgaagcaagcaagcccagtcgcatttaaaaaaatcaacaacaatgatgat
aatgaaaaaatctga

KEGG   Homo sapiens (human): 4887
Entry
4887              CDS       T01001                                 

Gene name
NPY2R, NPY2-R
Definition
(RefSeq) neuropeptide Y receptor Y2
  KO
K04205  neuropeptide Y receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4887 (NPY2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4887 (NPY2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    4887 (NPY2R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 4887
NCBI-ProteinID: NP_000901
OMIM: 162642
HGNC: 7957
Ensembl: ENSG00000185149
Vega: OTTHUMG00000161485
Pharos: P49146(Tchem)
UniProt: P49146
LinkDB
Position
4q32.1
AA seq 381 aa
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgggtccaataggtgcagaggctgatgagaaccagacagtggaagaaatgaaggtggaa
caatacgggccacaaacaactcctagaggtgaactggtccctgaccctgagccagagctt
atagatagtaccaagctgattgaggtacaagttgttctcatattggcctactgctccatc
atcttgcttggggtaattggcaactccttggtgatccatgtggtgatcaaattcaagagc
atgcgcacagtaaccaactttttcattgccaatctggctgtggcagatcttttggtgaac
actctgtgtctaccgttcactcttacctataccttaatgggggagtggaaaatgggtcct
gtcctgtgccacctggtgccctatgcccagggcctggcagtacaagtatccacaatcacc
ttgacagtaattgccctggaccggcacaggtgcatcgtctaccacctagagagcaagatc
tccaagcgaatcagcttcctgattattggcttggcctggggcatcagtgccctgctggca
agtcccctggccatcttccgggagtattcgctgattgagatcatcccggactttgagatt
gtggcctgtactgaaaagtggcctggcgaggagaagagcatctatggcactgtctatagt
ctttcttccttgttgatcttgtatgttttgcctctgggcattatatcattttcctacact
cgcatttggagtaaattgaagaaccatgtcagtcctggagctgcaaatgaccactaccat
cagcgaaggcaaaaaaccaccaaaatgctggtgtgtgtggtggtggtgtttgcggtcagc
tggctgcctctccatgccttccagcttgccgttgacattgacagccaggtcctggacctg
aaggagtacaaactcatcttcacagtgttccacatcatcgccatgtgctccacttttgcc
aatccccttctctatggctggatgaacagcaactacagaaaggctttcctctcggccttc
cgctgtgagcagcggttggatgccattcactctgaggtgtccgtgacattcaaggctaaa
aagaacctggaggtcagaaagaacagtggccccaatgactctttcacagaggctaccaat
gtctaa

KEGG   Homo sapiens (human): 4889
Entry
4889              CDS       T01001                                 

Gene name
NPY5R, NPY5-R, NPYR5, NPYY5-R
Definition
(RefSeq) neuropeptide Y receptor Y5
  KO
K04207  neuropeptide Y receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Velneperit: D08026
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4889 (NPY5R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4889 (NPY5R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    4889 (NPY5R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 4889
NCBI-ProteinID: NP_001304020
OMIM: 602001
HGNC: 7958
Ensembl: ENSG00000164129
Vega: OTTHUMG00000161353
Pharos: Q15761(Tchem)
UniProt: Q15761
LinkDB
Position
4q32.2
AA seq 445 aa
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggatttagagctcgacgagtattataacaagacacttgccacagagaataatactgct
gccactcggaattctgatttcccagtctgggatgactataaaagcagtgtagatgactta
cagtattttctgattgggctctatacatttgtaagtcttcttggctttatggggaatcta
cttattttaatggctctcatgaaaaagcgtaatcagaagactacggtaaacttcctcata
ggcaatctggccttttctgatatcttggttgtgctgttttgctcacctttcacactgacg
tctgtcttgctggatcagtggatgtttggcaaagtcatgtgccatattatgccttttctt
caatgtgtgtcagttttggtttcaactttaattttaatatcaattgccattgtcaggtat
catatgataaaacatcccatatctaataatttaacagcaaaccatggctactttctgata
gctactgtctggacactaggttttgccatctgttctccccttccagtgtttcacagtctt
gtggaacttcaagaaacatttggttcagcattgctgagcagcaggtatttatgtgttgag
tcatggccatctgattcatacagaattgcctttactatctctttattgctagttcagtat
attctgcccttagtttgtcttactgtaagtcatacaagtgtctgcagaagtataagctgt
ggattgtccaacaaagaaaacagacttgaagaaaatgagatgatcaacttaactcttcat
ccatccaaaaagagtgggcctcaggtgaaactctctggcagccataaatggagttattca
ttcatcaaaaaacacagaagaagatatagcaagaagacagcatgtgtgttacctgctcca
gaaagaccttctcaagagaaccactccagaatacttccagaaaactttggctctgtaaga
agtcagctctcttcatccagtaagttcataccaggggtccccacttgctttgagataaaa
cctgaagaaaattcagatgttcatgaattgagagtaaaacgttctgttacaagaataaaa
aagagatctcgaagtgttttctacagactgaccatactgatattagtatttgctgttagt
tggatgccactacaccttttccatgtggtaactgattttaatgacaatcttatttcaaat
aggcatttcaagttggtgtattgcatttgtcatttgttgggcatgatgtcctgttgtctt
aatccaattctatatgggtttcttaataatgggattaaagctgatttagtgtcccttata
cactgtcttcatatgtaa

KEGG   Homo sapiens (human): 5540
Entry
5540              CDS       T01001                                 

Gene name
NPY4R, NPY4-R, PP1, PPYR1, Y4
Definition
(RefSeq) neuropeptide Y receptor Y4
  KO
K04206  neuropeptide Y receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5540 (NPY4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5540 (NPY4R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    5540 (NPY4R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF2298 Piezo_RRas_bdg DUF4790 PsbW
Other DBs
NCBI-GeneID: 5540
NCBI-ProteinID: NP_001265723
OMIM: 601790
HGNC: 9329
Ensembl: ENSG00000204174
Vega: OTTHUMG00000018108
Pharos: P50391(Tchem)
UniProt: P50391
LinkDB
Position
10q11.22
AA seq 375 aa
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL
CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI
QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL
ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRC
LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG
NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
VSKGSLRLSGRSNPI
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaacacctctcacctcctggccttgctgctcccaaaatctccacaaggtgaaaacaga
agcaaacccctgggcaccccatacaacttctctgaacattgccaggattccgtggacgtg
atggtcttcatcgtcacttcctacagcattgagactgtcgtgggggtcctgggtaacctc
tgcctgatgtgtgtgactgtgaggcagaaggagaaagccaacgtgaccaacctgcttatc
gccaacctggccttctctgacttcctcatgtgcctcctctgccagccgctgaccgccgtc
tacaccatcatggactactggatctttggagagaccctctgcaagatgtcggccttcatc
cagtgcatgtcggtgacggtctccatcctctcgctcgtcctcgtggccctggagaggcat
cagctcatcatcaacccaacaggctggaagcccagcatctcacaggcctacctggggatt
gtgctcatctgggtcattgcctgtgtcctctccctgcccttcctggccaacagcatcctg
gagaatgtcttccacaagaaccactccaaggctctggagttcctggcggataaggtggtc
tgtaccgagtcctggccactggctcaccaccgcaccatctacaccaccttcctgctcctc
ttccagtactgcctcccactgggcttcatcttggtctgttatgcacgcatctaccggtgc
ctgcagaggcaggggcgcgtgtttcacaagggcacctacagcttgcgagctgggcacatg
aagcaggtcaatgtggtgctggtggtgatggtggtggcctttgccgtgctctggctgcct
ctgcatgtgttcaacagcctggaagactggcaccatgaggccatccccatctgccatggg
aacctcatcttcttagtgtgccacttgcttgccatggcctccacctgtgtcaacccattc
atctatggctttctcaacaccaacttcaagaaggagatcaaggccctggtgctgacttgc
cagcagagcgcccccctggaggagtcagagcatctgcccctgtccacagtacatacggaa
gtctccaaagggtccctgaggctaagtggcaggtccaatcccatttaa

DBGET integrated database retrieval system