KEGG   Homo sapiens (human): 10201
Entry
10201             CDS       T01001                                 

Gene name
NME6, IPIA-ALPHA, NDK_6, NM23-H6
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    10201 (NME6)
   00240 Pyrimidine metabolism
    10201 (NME6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    10201 (NME6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10201 (NME6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     10201 (NME6)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    10201 (NME6)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 10201
NCBI-ProteinID: NP_001295355
OMIM: 608294
HGNC: 20567
Ensembl: ENSG00000172113
Vega: OTTHUMG00000133531
Pharos: O75414(Tbio)
UniProt: O75414
LinkDB
Position
3p21.31
AA seq 186 aa
MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFY
REHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGT
GGLGPA
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcctcaatcttgcgaagccctcaggctctccagctcactctagccctgatcaagcct
gacgcagtcgcccatccactgattctggaggctgttcatcagcagattctaagcaacaag
ttcctgattgtacgaatgagagaactactgtggagaaaggaagattgccagaggttttac
cgagagcatgaagggcgttttttctatcagaggctggtggagttcatggccagcgggcca
atccgagcctacatccttgcccacaaggatgccatccagctctggaggacgctcatggga
cccaccagagtgttccgagcacgccatgtggccccagattctatccgtgggagtttcggc
ctcactgacacccgcaacaccacccatggttcggactctgtggtttcagccagcagagag
attgcagccttcttccctgacttcagtgaacagcgctggtatgaggaggaagagccccag
ttgcgctgtggccctgtgtgctatagcccagagggaggtgtccactatgtagctggaaca
ggaggcctaggaccagcctga

KEGG   Homo sapiens (human): 29922
Entry
29922             CDS       T01001                                 

Gene name
NME7, CFAP67, MN23H7, NDK_7, NDK7, nm23-H7
Definition
(RefSeq) NME/NM23 family member 7
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    29922 (NME7)
   00240 Pyrimidine metabolism
    29922 (NME7)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    29922 (NME7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29922 (NME7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     29922 (NME7)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    29922 (NME7)
SSDB
Motif
Pfam: NDK DUF1126 ACT_5 Arg_repressor
Other DBs
NCBI-GeneID: 29922
NCBI-ProteinID: NP_037462
OMIM: 613465
HGNC: 20461
Ensembl: ENSG00000143156
Vega: OTTHUMG00000034586
Pharos: Q9Y5B8(Tbio)
UniProt: Q9Y5B8
LinkDB
Position
1q24.2
AA seq 376 aa
MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDL
FIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTI
TKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPAN
SGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCT
CCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT
EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLP
EDGLLEVQYFFKILDN
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaatcatagtgaaagattcgttttcattgcagagtggtatgatccaaatgcttcactt
cttcgacgttatgagcttttattttacccaggggatggatctgttgaaatgcatgatgta
aagaatcatcgcacctttttaaagcggaccaaatatgataacctgcacttggaagattta
tttataggcaacaaagtgaatgtcttttctcgacaactggtattaattgactatggggat
caatatacagctcgccagctgggcagtaggaaagaaaaaacgctagccctaattaaacca
gatgcaatatcaaaggctggagaaataattgaaataataaacaaagctggatttactata
accaaactcaaaatgatgatgctttcaaggaaagaagcattggattttcatgtagatcac
cagtcaagaccctttttcaatgagctgatccagtttattacaactggtcctattattgcc
atggagattttaagagatgatgctatatgtgaatggaaaagactgctgggacctgcaaac
tctggagtggcacgcacagatgcttctgaaagcattagagccctctttggaacagatggc
ataagaaatgcagcgcatggccctgattcttttgcttctgcggccagagaaatggagttg
ttttttccttcaagtggaggttgtgggccggcaaacactgctaaatttactaattgtacc
tgttgcattgttaaaccccatgctgtcagtgaaggactgttgggaaagatcctgatggct
atccgagatgcaggttttgaaatctcagctatgcagatgttcaatatggatcgggttaat
gttgaggaattctatgaagtttataaaggagtagtgaccgaatatcatgacatggtgaca
gaaatgtattctggcccttgtgtagcaatggagattcaacagaataatgctacaaagaca
tttcgagaattttgtggacctgctgatcctgaaattgcccggcatttacgccctggaact
ctcagagcaatctttggtaaaactaagatccagaatgctgttcactgtactgatctgcca
gaggatggcctattagaggttcaatacttcttcaagatcttggataattag

KEGG   Homo sapiens (human): 4830
Entry
4830              CDS       T01001                                 

Gene name
NME1, AWD, GAAD, NB, NBS, NDKA, NDPK-A, NDPKA, NM23, NM23-H1
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4830 (NME1)
   00240 Pyrimidine metabolism
    4830 (NME1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4830 (NME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4830 (NME1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4830 (NME1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4830 (NME1)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 4830
NCBI-ProteinID: NP_000260
OMIM: 156490
HGNC: 7849
Ensembl: ENSG00000239672
Vega: OTTHUMG00000137474
Pharos: P15531(Tbio)
UniProt: P15531 A0A384MTW7
LinkDB
Structure
PDB: 

Position
17q21.33
AA seq 152 aa
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccaactgtgagcgtaccttcattgcgatcaaaccagatggggtccagcggggtctt
gtgggagagattatcaagcgttttgagcagaaaggattccgccttgttggtctgaaattc
atgcaagcttccgaagatcttctcaaggaacactacgttgacctgaaggaccgtccattc
tttgccggcctggtgaaatacatgcactcagggccggtagttgccatggtctgggagggg
ctgaatgtggtgaagacgggccgagtcatgctcggggagaccaaccctgcagactccaag
cctgggaccatccgtggagacttctgcatacaagttggcaggaacattatacatggcagt
gattctgtggagagtgcagagaaggagatcggcttgtggtttcaccctgaggaactggta
gattacacgagctgtgctcagaactggatctatgaatga

KEGG   Homo sapiens (human): 4831
Entry
4831              CDS       T01001                                 

Gene name
NME2, NDKB, NDPK-B, NDPKB, NM23-H2, NM23B, PUF
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 2
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4831 (NME2)
   00240 Pyrimidine metabolism
    4831 (NME2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4831 (NME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4831 (NME2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4831 (NME2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4831 (NME2)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 4831
NCBI-ProteinID: NP_001018147
OMIM: 156491
HGNC: 7850
Ensembl: ENSG00000243678
Vega: OTTHUMG00000154062
UniProt: P22392 Q6FHN3
LinkDB
Structure
PDB: 
3BBB 3BBC 3BBF 1NUE 1NSK

Position
17q21.33
AA seq 152 aa
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccaacctggagcgcaccttcatcgccatcaagccggacggcgtgcagcgcggcctg
gtgggcgagatcatcaagcgcttcgagcagaagggattccgcctcgtggccatgaagttc
ctccgggcctctgaagaacacctgaagcagcactacattgacctgaaagaccgaccattc
ttccctgggctggtgaagtacatgaactcagggccggttgtggccatggtctgggagggg
ctgaacgtggtgaagacaggccgagtgatgcttggggagaccaatccagcagattcaaag
ccaggcaccattcgtggggacttctgcattcaggttggcaggaacatcattcatggcagt
gattcagtaaaaagtgctgaaaaagaaatcagcctatggtttaagcctgaagaactggtt
gactacaagtcttgtgctcatgactgggtctatgaataa

KEGG   Homo sapiens (human): 4832
Entry
4832              CDS       T01001                                 

Gene name
NME3, DR-nm23, NDPK-C, NDPKC, NM23-H3, NM23H3, c371H6.2
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 3
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4832 (NME3)
   00240 Pyrimidine metabolism
    4832 (NME3)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4832 (NME3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4832 (NME3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4832 (NME3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4832 (NME3)
SSDB
Motif
Pfam: NDK Amidohydro_2
Other DBs
NCBI-GeneID: 4832
NCBI-ProteinID: NP_002504
OMIM: 601817
HGNC: 7851
Ensembl: ENSG00000103024
Vega: OTTHUMG00000128635
Pharos: Q13232(Tbio)
UniProt: Q13232
LinkDB
Structure
PDB: 
1ZS6

Position
16p13.3
AA seq 169 aa
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
SEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGT
IRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgatctgcctggtgctgaccatcttcgctaacctcttccccgcggcctgcaccggcgca
cacgaacgcaccttcctggccgtgaagccggacggcgtgcagcggcggctggtgggcgag
attgtgcggcgcttcgagaggaagggcttcaagttggtggcgctgaagctggtgcaggcc
tccgaggagctgctgcgtgagcactacgccgagctgcgtgaacgcccgttctacggccgc
cttgtcaagtatatggcctccgggccggtggtggccatggtatggcaggggctggacgtg
gtgcgcacctcgcgggcgctcatcggagccacgaacccggccgacgccccgcccggcacc
atccgcggggatttctgcatcgaggttggcaagaacctgattcacggcagcgactcggtg
gagagtgcccgccgcgagatcgctctctggttccgcgcagacgagctcctctgctgggag
gacagcgctgggcactggctgtatgagtag

KEGG   Homo sapiens (human): 4833
Entry
4833              CDS       T01001                                 

Gene name
NME4, NDPK-D, NM23H4, nm23-H4
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 4
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4833 (NME4)
   00240 Pyrimidine metabolism
    4833 (NME4)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4833 (NME4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4833 (NME4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4833 (NME4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4833 (NME4)
SSDB
Motif
Pfam: NDK PSI_PsaJ
Other DBs
NCBI-GeneID: 4833
NCBI-ProteinID: NP_005000
OMIM: 601818
HGNC: 7852
Ensembl: ENSG00000103202
Vega: OTTHUMG00000047995
Pharos: O00746(Tbio)
UniProt: O00746
LinkDB
Structure
PDB: 
1EHW

Position
16p13.3
AA seq 187 aa
MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQR
FERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRAS
RAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQ
HSSIHPA
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggcggcctcttctggcgctccgcgctgcgggggctgcgctgcggcccgcgggccccg
ggcccgagcctgctagtgcgccacggctcgggagggccctcctggacccgggagcggacc
ctggtggcggtgaagcccgatggcgtgcaacggcggctcgttggggacgtgatccagcgc
tttgagaggcggggcttcacgctggtggggatgaagatgctgcaggcaccagagagcgtc
cttgccgagcactaccaggacctgcggaggaagcccttctaccctgccctcatccgctac
atgagctctgggcctgtggtggccatggtctgggaagggtacaatgtcgtccgcgcctcg
agggccatgattggacacaccgactcggctgaggctgccccaggaaccataaggggtgac
ttcagcgtccacatcagcaggaatgtcatccacgccagcgactccgtggagggggcccag
cgggagatccagctgtggttccagagcagtgagctggtgagctgggcagacgggggccag
cacagcagcatccacccagcctga

KEGG   Homo sapiens (human): 654364
Entry
654364            CDS       T01001                                 

Gene name
NME1-NME2, NM23-LV, NMELV
Definition
(RefSeq) NME1-NME2 readthrough
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    654364 (NME1-NME2)
   00240 Pyrimidine metabolism
    654364 (NME1-NME2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    654364 (NME1-NME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    654364 (NME1-NME2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     654364 (NME1-NME2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    654364 (NME1-NME2)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 654364
NCBI-ProteinID: NP_001018146
HGNC: 33531
Ensembl: ENSG00000011052
Vega: OTTHUMG00000137475
Pharos: P22392(Tbio)
UniProt: P22392
LinkDB
Structure
PDB: 
3BBB 3BBC 3BBF 1NUE 1NSK

Position
17q21.33
AA seq 267 aa
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRTMANLE
RTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLV
KYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKS
AEKEISLWFKPEELVDYKSCAHDWVYE
NT seq 804 nt   +upstreamnt  +downstreamnt
atggccaactgtgagcgtaccttcattgcgatcaaaccagatggggtccagcggggtctt
gtgggagagattatcaagcgttttgagcagaaaggattccgccttgttggtctgaaattc
atgcaagcttccgaagatcttctcaaggaacactacgttgacctgaaggaccgtccattc
tttgccggcctggtgaaatacatgcactcagggccggtagttgccatggtctgggagggg
ctgaatgtggtgaagacgggccgagtcatgctcggggagaccaaccctgcagactccaag
cctgggaccatccgtggagacttctgcatacaagttggcaggaccatggccaacctggag
cgcaccttcatcgccatcaagccggacggcgtgcagcgcggcctggtgggcgagatcatc
aagcgcttcgagcagaagggattccgcctcgtggccatgaagttcctccgggcctctgaa
gaacacctgaagcagcactacattgacctgaaagaccgaccattcttccctgggctggtg
aagtacatgaactcagggccggttgtggccatggtctgggaggggctgaacgtggtgaag
acaggccgagtgatgcttggggagaccaatccagcagattcaaagccaggcaccattcgt
ggggacttctgcattcaggttggcaggaacatcattcatggcagtgattcagtaaaaagt
gctgaaaaagaaatcagcctatggtttaagcctgaagaactggttgactacaagtcttgt
gctcatgactgggtctatgaataa

DBGET integrated database retrieval system