KEGG   Homo sapiens (human): 10316
Entry
10316             CDS       T01001                                 

Gene name
NMUR1, (FM-3), FM-3, FM3, GPC-R, GPR66, NMU1R
Definition
(RefSeq) neuromedin U receptor 1
  KO
K05052  neuromedin U receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10316 (NMUR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10316 (NMUR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuromedin U
    10316 (NMUR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv DUF2569 NADHdeh_related
Other DBs
NCBI-GeneID: 10316
NCBI-ProteinID: NP_006047
OMIM: 604153
HGNC: 4518
Ensembl: ENSG00000171596
Vega: OTTHUMG00000133225
Pharos: Q9HB89(Tchem)
UniProt: Q9HB89
LinkDB
Position
2q37.1
AA seq 426 aa
MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELF
MPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYE
MWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRR
VLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFF
CLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLF
VLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMS
SRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ
QETDPS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgactcctctctgcctcaattgctctgtcctccctggagacctgtacccagggggtgca
aggaaccccatggcttgcaatggcagtgcggccagggggcactttgaccctgaggacttg
aacctgactgacgaggcactgagactcaagtacctggggccccagcagacagagctgttc
atgcccatctgtgccacatacctgctgatcttcgtggtgggcgctgtgggcaatgggctg
acctgtctggtcatcctgcgccacaaggccatgcgcacgcctaccaactactacctcttc
agcctggccgtgtcggacctgctggtgctgctggtgggcctgcccctggagctctatgag
atgtggcacaactaccccttcctgctgggcgttggtggctgctatttccgcacgctactg
tttgagatggtctgcctggcctcagtgctcaacgtcactgccctgagcgtggaacgctat
gtggccgtggtgcacccactccaggccaggtccatggtgacgcgggcccatgtgcgccga
gtgcttggggccgtctggggtcttgccatgctctgctccctgcccaacaccagcctgcac
ggcatccggcagctgcacgtgccctgccggggcccagtgccagactcagctgtttgcatg
ctggtccgcccacgggccctctacaacatggtagtgcagaccaccgcgctgctcttcttc
tgcctgcccatggccatcatgagcgtgctctacctgctcattgggctgcgactgcggcgg
gagaggctgctgctcatgcaggaggccaagggcaggggctctgcagcagccaggtccaga
tacacctgcaggctccagcagcacgatcggggccggagacaagtgaccaagatgctgttt
gtcctggtcgtggtgtttggcatctgctgggccccgttccacgccgaccgcgtcatgtgg
agcgtcgtgtcacagtggacagatggcctgcacctggccttccagcacgtgcacgtcatc
tccggcatcttcttctacctgggctcggcggccaaccccgtgctctatagcctcatgtcc
agccgcttccgagagaccttccaggaggccctgtgcctcggggcctgctgccatcgcctc
agaccccgccacagctcccacagcctcagcaggatgaccacaggcagcaccctgtgtgat
gtgggctccctgggcagctgggtccaccccctggctgggaacgatggcccagaggcgcag
caagagaccgatccatcctga

KEGG   Homo sapiens (human): 56923
Entry
56923             CDS       T01001                                 

Gene name
NMUR2, FM-4, FM4, NMU-R2, NMU2R, TGR-1, TGR1
Definition
(RefSeq) neuromedin U receptor 2
  KO
K05053  neuromedin U receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56923 (NMUR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    56923 (NMUR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuromedin U
    56923 (NMUR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4 Rab5ip Ceramidase
Other DBs
NCBI-GeneID: 56923
NCBI-ProteinID: NP_064552
OMIM: 605108
HGNC: 16454
Ensembl: ENSG00000132911
Vega: OTTHUMG00000130131
Pharos: Q9GZQ4(Tchem)
UniProt: Q9GZQ4
LinkDB
Position
5q33.1
AA seq 415 aa
MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV
IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY
FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP
NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA
LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES
LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA
QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtcagggatggaaaaacttcagaatgcttcctggatctaccagcagaaactagaagat
ccattccagaaacacctgaacagcaccgaggagtatctggccttcctctgcggacctcgg
cgcagccacttcttcctccccgtgtctgtggtgtatgtgccaatttttgtggtgggggtc
attggcaatgtcctggtgtgcctggtgattctgcagcaccaggctatgaagacgcccacc
aactactacctcttcagcctggcggtctctgacctcctggtcctgctccttggaatgccc
ctggaggtctatgagatgtggcgcaactaccctttcttgttcgggcccgtgggctgctac
ttcaagacggccctctttgagaccgtgtgcttcgcctccatcctcagcatcaccaccgtc
agcgtggagcgctacgtggccatcctacacccgttccgcgccaaactgcagagcacccgg
cgccgggccctcaggatcctcggcatcgtctggggcttctccgtgctcttctccctgccc
aacaccagcatccatggcatcaagttccactacttccccaatgggtccctggtcccaggt
tcggccacctgtacggtcatcaagcccatgtggatctacaatttcatcatccaggtcacc
tccttcctattctacctcctccccatgactgtcatcagtgtcctctactacctcatggca
ctcagactaaagaaagacaaatctcttgaggcagatgaagggaatgcaaatattcaaaga
ccctgcagaaaatcagtcaacaagatgctgtttgtcttggtcttagtgtttgctatctgt
tgggccccgttccacattgaccgactcttcttcagctttgtggaggagtggagtgaatcc
ctggctgctgtgttcaacctcgtccatgtggtgtcaggtgtcttcttctacctgagctca
gctgtcaaccccattatctataacctactgtctcgccgcttccaggcagcattccagaat
gtgatctcttctttccacaaacagtggcactcccagcatgacccacagttgccacctgcc
cagcggaacatcttcctgacagaatgccactttgtggagctgaccgaagatataggtccc
caattcccatgtcagtcatccatgcacaactctcacctcccagcagccctctctagtgaa
cagatgtcaagaacaaactatcaaagcttccactttaacaaaacctga

DBGET integrated database retrieval system