KEGG   Homo sapiens (human): 10599
Entry
10599             CDS       T01001                                 

Gene name
SLCO1B1, HBLRR, LST-1, LST1, OATP-C, OATP1B1, OATP2, OATPC, SLC21A6
Definition
(RefSeq) solute carrier organic anion transporter family member 1B1
  KO
K05043  solute carrier organic anion transporter family, member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Disease
H00208  Hyperbilirubinemia
H02057  Rotor syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    10599 (SLCO1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10599 (SLCO1B1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   10599 (SLCO1B1)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 EI24 SP24
Other DBs
NCBI-GeneID: 10599
NCBI-ProteinID: NP_006437
OMIM: 604843
HGNC: 10959
Ensembl: ENSG00000134538
Vega: OTTHUMG00000169047
Pharos: Q9Y6L6(Tchem)
UniProt: Q9Y6L6 A0A024RAU7 Q05CV5
LinkDB
Position
12p12.1
AA seq 691 aa
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggaccaaaatcaacatttgaataaaacagcagaggcacaaccttcagagaataagaaa
acaagatactgcaatggattgaagatgttcttggcagctctgtcactcagctttattgct
aagacactaggtgcaattattatgaaaagttccatcattcatatagaacggagatttgag
atatcctcttctcttgttggttttattgacggaagctttgaaattggaaatttgcttgtg
attgtatttgtgagttactttggatccaaactacatagaccaaagttaattggaatcggt
tgtttcattatgggaattggaggtgttttgactgctttgccacatttcttcatgggatat
tacaggtattctaaagaaactaatatcaattcatcagaaaattcaacatcgaccttatcc
acttgtttaattaatcaaattttatcactcaatagagcatcacctgagatagtgggaaaa
ggttgtttaaaggaatctgggtcatacatgtggatatatgtgttcatgggtaatatgctt
cgtggaataggggagactcccatagtaccattggggctttcttacattgatgatttcgct
aaagaaggacattcttctttgtatttaggtatattgaatgcaatagcaatgattggtcca
atcattggctttaccctgggatctctgttttctaaaatgtacgtggatattggatatgta
gatctaagcactatcaggataactcctactgattctcgatgggttggagcttggtggctt
aatttccttgtgtctggactattctccattatttcttccataccattctttttcttgccc
caaactccaaataaaccacaaaaagaaagaaaagcttcactgtctttgcatgtgctggaa
acaaatgatgaaaaggatcaaacagctaatttgaccaatcaaggaaaaaatattaccaaa
aatgtgactggttttttccagtcttttaaaagcatccttactaatcccctgtatgttatg
tttgtgcttttgacgttgttacaagtaagcagctatattggtgcttttacttatgtcttc
aaatacgtagagcaacagtatggtcagccttcatctaaggctaacatcttattgggagtc
ataaccatacctatttttgcaagtggaatgtttttaggaggatatatcattaaaaaattc
aaactgaacaccgttggaattgccaaattctcatgttttactgctgtgatgtcattgtcc
ttttacctattatattttttcatactctgtgaaaacaaatcagttgccggactaaccatg
acctatgatggaaataatccagtgacatctcatagagatgtaccactttcttattgcaac
tcagactgcaattgtgatgaaagtcaatgggaaccagtctgtggaaacaatggaataact
tacatctcaccctgtctagcaggttgcaaatcttcaagtggcaataaaaagcctatagtg
ttttacaactgcagttgtttggaagtaactggtctccagaacagaaattactcagcccat
ttgggtgaatgcccaagagatgatgcttgtacaaggaaattttacttttttgttgcaata
caagtcttgaatttatttttctctgcacttggaggcacctcacatgtcatgctgattgtt
aaaattgttcaacctgaattgaaatcacttgcactgggtttccactcaatggttatacga
gcactaggaggaattctagctccaatatattttggggctctgattgatacaacgtgtata
aagtggtccaccaacaactgtggcacacgtgggtcatgtaggacatataattccacatca
ttttcaagggtctacttgggcttgtcttcaatgttaagagtctcatcacttgttttatat
attatattaatttatgccatgaagaaaaaatatcaagagaaagatatcaatgcatcagaa
aatggaagtgtcatggatgaagcaaacttagaatccttaaataaaaataaacattttgtc
ccttctgctggggcagatagtgaaacacattgttaa

KEGG   Homo sapiens (human): 28234
Entry
28234             CDS       T01001                                 

Gene name
SLCO1B3, HBLRR, LST-2, LST-3TM13, LST3, OATP-8, OATP1B3, OATP8, SLC21A8
Definition
(RefSeq) solute carrier organic anion transporter family member 1B3
  KO
K05043  solute carrier organic anion transporter family, member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Disease
H00208  Hyperbilirubinemia
H02057  Rotor syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    28234 (SLCO1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    28234 (SLCO1B3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   28234 (SLCO1B3)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Other DBs
NCBI-GeneID: 28234
NCBI-ProteinID: NP_062818
OMIM: 605495
HGNC: 10961
Ensembl: ENSG00000111700
Vega: OTTHUMG00000169011
Pharos: Q9NPD5(Tchem)
UniProt: Q9NPD5 B3KP78
LinkDB
Position
12p12.2
AA seq 702 aa
MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
NT seq 2109 nt   +upstreamnt  +downstreamnt
atggaccaacatcaacatttgaataaaacagcagagtcagcatcttcagagaaaaagaaa
acaagacgctgcaatggattcaagatgttcttggcagccctgtcattcagctatattgct
aaagcactaggtggaatcattatgaaaatttccatcactcaaatagaaaggagatttgac
atatcctcttctcttgctggtttaattgatggaagctttgaaattggaaatttgcttgtg
attgtatttgtaagttactttggatctaaactacacagaccgaagttaattggaattggt
tgtctccttatgggaactggaagtattttgacatctttaccacatttcttcatgggatat
tataggtattctaaagaaacccatattaatccatcagaaaattcaacatcaagtttatca
acctgtttaattaatcaaaccttatcattcaatggaacatcacctgagatagtagaaaaa
gattgtgtaaaggaatctgggtcacacatgtggatctatgtcttcatggggaatatgctt
cgtggcataggggaaacccccatagtaccattggggatttcatacattgatgattttgca
aaagaaggacattcttccttgtatttaggtagtttgaatgcaataggaatgattggtcca
gtcattggctttgcactgggatctctgtttgctaaaatgtacgtggatattggatatgta
gatctgagcactatcagaataactcctaaggactctcgttgggttggagcttggtggctt
ggtttccttgtgtctggactattttccattatttcttccataccattttttttcttgccg
aaaaatccaaataaaccacaaaaagaaagaaaaatttcactatcattgcatgtgctgaaa
acaaatgatgatagaaatcaaacagctaatttgaccaaccaaggaaaaaatgttaccaaa
aatgtgactggttttttccagtctttgaaaagcatccttaccaatcccctgtatgttata
tttctgcttttgacattgttacaagtaagcagctttattggttcttttacttacgtcttt
aaatatatggagcaacagtacggtcagtctgcatctcatgctaactttttgttgggaatc
ataaccattcctacggttgcaactggaatgtttttaggaggatttatcattaaaaaattc
aaattgtctttagttggaattgccaaattttcatttcttacttcgatgatatccttcttg
tttcaacttctatatttccctctaatctgcgaaagcaaatcagttgccggcctaaccttg
acctatgatggaaataattcagtggcatctcatgtagatgtaccactttcttattgcaac
tcagagtgcaattgtgatgaaagtcagtgggaaccagtctgtgggaacaatggaataact
tacctgtcaccttgtctagcaggatgcaaatcctcaagtggtattaaaaagcatacagtg
ttttataactgtagttgtgtggaagtaactggtctccagaacagaaattactcagcacac
ttgggtgaatgcccaagagataatacttgtacaaggaaatttttcatctatgttgcaatt
caagtcataaactctttgttctctgcaacaggaggtaccacatttatcttgttgactgtg
aagattgttcaacctgaattgaaagcacttgcaatgggtttccagtcaatggttataaga
acactaggaggaattctagctccaatatattttggggctctgattgataaaacatgtatg
aagtggtccaccaacagctgtggagcacaaggggcttgtaggatatataattccgtattt
tttggaagggtctacttgggcttatctatagctttaagattcccagcacttgttttatat
attgttttcatttttgctatgaagaaaaaatttcaaggaaaagataccaaggcatcggac
aatgaaagaaaagtaatggatgaagcaaacttagaattcttaaataatggtgaacatttt
gtaccttctgctggaacagatagtaaaacatgtaatttggacatgcaagacaatgctgct
gccaactaa

KEGG   Homo sapiens (human): 338821
Entry
338821            CDS       T01001                                 

Gene name
SLCO1B7, LST-3, LST-3TM12, LST3, SLC21A21
Definition
(RefSeq) solute carrier organic anion transporter family member 1B7 (putative)
  KO
K05043  solute carrier organic anion transporter family, member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    338821 (SLCO1B7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    338821 (SLCO1B7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   338821 (SLCO1B7)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Sugar_tr Kazal_1 Lig_chan
Other DBs
NCBI-GeneID: 338821
NCBI-ProteinID: NP_001009562
HGNC: 32934
Ensembl: ENSG00000205754
Vega: OTTHUMG00000169045
Pharos: G3V0H7(Tdark)
UniProt: G3V0H7
LinkDB
Position
12p12.2
AA seq 640 aa
MKISTTQIERRFEISSSLVGLIDGSFEIGNLFVIVFVSYFGSKLHRPKLIGIGCFLMGTG
SILMALPHFFMGYYRYSKETNIDPSENSTSNLPNCLINQMLSLNRTPSEIIERGCVKESG
SHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLGTVNVMGMTGLVFAFMLG
SLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGIVSIISSIPFFFLPLNPNKPQ
KERKVSLFLHVLKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLL
HMSSYIASLTYIIKMVEQQYGWSASKTNFLLGVLALPAVAIGMFSGGYIIKKFKLSLVGL
AKLAFCSATVHLLSQVLYFFLICESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDE
SQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRD
DACTRKSYVYFVIQVLDAFLCAVGLTSYSVLVIRIVQPELKALAIGFHSMIMRSLGGILV
PIYFGALIDTTCMKWSTNSCGARGACRIYNSTYLGRAFFGLKVALIFPVLVLLTVFIFVV
RKKSHGKDTKVLENERQVMDEANLEFLNDSEHFVPSAEEQ
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgaaaatatcaaccactcaaatagaaaggagatttgagatatcctcttctcttgttggt
ttaattgatggaagcttcgaaataggaaatttgtttgtgattgtatttgtaagttacttt
ggatctaaactacacagaccgaagttaattggaattggttgttttcttatgggaactgga
agtattttgatggctttaccacatttcttcatgggatattacaggtattctaaagaaacc
aatattgatccatcagaaaattcaacatcaaacttaccaaactgtttaattaatcaaatg
ttatcactcaatagaacaccgtctgagataatagaaagaggttgtgtgaaggaatctggg
tcacacatgtggatctatgtcttcatgggtaatatgcttcgtggcataggggaaaccccc
atagtaccattggggatttcttacattgatgattttgcaaaagaaggacattcttccttg
tatttaggtactgtgaatgtaatgggaatgactggtctagtttttgcctttatgctggga
tctctgtttgctaaaatgtatgtggatatcggatatgtggatctgagcactatcaggata
actcctaaggactctcgttgggttggagcttggtggcttggtttccttgtgtctggaata
gtatccattatttcttctataccattctttttcttgcctctaaatccaaataaaccacag
aaagaaaggaaagtttcactatttttgcatgtgctaaaaactaatgataaaaggaatcaa
atagctaatttgaccaaccgaagaaaatatattaccaaaaatgtgactggctttttccag
tctttgaaaagcatccttaccaatcccctgtatgttatatttgtaatttttacattgtta
cacatgagcagctacattgcttctcttacttatatcattaaaatggtggagcaacagtat
ggttggtctgcatctaagactaactttttgttgggagtcctcgccctacctgctgttgca
attggcatgttttcaggaggatatatcattaaaaaattcaaattgtctttagttggactt
gccaaattggcattttgttctgcaacagtgcatctcttatctcaagttttatatttcttt
ctaatctgtgaaagcaaatcagttgccggcctaaccttgacctatgatggaaatagtcca
gtaagatctcatgtagatgtaccactttcttattgcaactcagagtgcaattgtgatgaa
agtcaatgggaacccgtctgtggaaacaatggaataacttacctgtcaccttgtctagca
ggatgcaaatcttcaagtggtaataaagagcccatagtgttttataactgtagctgtgtg
gaagtaattggtctccagaacaaaaattactcagcgcacttgggtgaatgcccaagagat
gatgcttgtacaaggaaatcttacgtttattttgtaattcaagtcttagatgctttcctc
tgtgcagttggacttacctcatattccgtgctggtgattaggattgttcaacctgaattg
aaagcacttgcaatcggcttccattcaatgattatgcgatcgctaggaggtattctagtt
ccaatatattttggggctctgattgatacaacgtgtatgaagtggtccaccaacagctgt
ggagcacgaggggcttgtaggatatataattccacatatttgggaagagccttcttcggc
ttgaaggtagccctaatatttccagtacttgttttacttactgtatttatttttgttgta
aggaaaaaatcccatggaaaggataccaaagtattagaaaatgaaagacaagtaatggat
gaagcaaacttagaattcttaaacgacagtgaacattttgtaccttctgctgaagaacag
taa

KEGG   Homo sapiens (human): 6579
Entry
6579              CDS       T01001                                 

Gene name
SLCO1A2, OATP, OATP-A, OATP1A2, SLC21A3
Definition
(RefSeq) solute carrier organic anion transporter family member 1A2
  KO
K03460  solute carrier organic anion transporter family, member 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    6579 (SLCO1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6579 (SLCO1A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   6579 (SLCO1A2)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 ASFV_L11L
Other DBs
NCBI-GeneID: 6579
NCBI-ProteinID: NP_066580
OMIM: 602883
HGNC: 10956
Ensembl: ENSG00000084453
Vega: OTTHUMG00000156259
Pharos: P46721(Tbio)
UniProt: P46721 A0A024RAT5
LinkDB
Position
12p12.1
AA seq 670 aa
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgggagaaactgagaaaagaattgaaacccatagaataagatgtctttccaagttgaag
atgtttctgttggcaataacatgtgcatttgtatccaaaacactgtctggatcttatatg
aattccatgctcacacaaatagagagacaattcaacatcccaacatctctagttggattc
attaatggaagctttgagattggaaatcttttgttgattatatttgtgagttattttgga
accaaactgcatagacctataatgattggcattggatgtgtggttatgggcttaggctgt
ttcttaaaatcactacctcatttcctcatgaaccaatatgaatatgaatctacagtttca
gtttcaggcaacttgtcctcaaacagtttcttgtgtatggaaaatggaacccagatttta
agaccaacgcaggatccatcagagtgtacaaaggaagttaaatcattaatgtgggtgtac
gtcctagtaggcaatattgtacgtggaatgggtgaaactcccatcctgcctttgggtatt
tcctatatagaagattttgccaaatttgaaaattctcctttatatattgggcttgtagaa
acaggagctattattggtcctttgattggacttttgttggcatcattctgtgcaaatgtt
tatgttgacactggatttgtgaacacagatgatctgatcataactcccactgacactcgt
tgggtcggtgcatggtggtttggctttctgatttgtgcaggagttaacgtgctcactgcc
attccttttttctttttgcccaacacacttccaaaggaaggactagagactaatgctgac
atcattaaaaatgaaaatgaagacaaacaaaaagaagaggtcaagaaggaaaaatatgga
atcactaaagattttctacctttcatgaaaagtctttcctgcaatccaatttatatgctt
ttcatacttgtaagtgtgatacagttcaatgcattcgttaacatgatctccttcatgcct
aaatacctagaacagcaatatggaatatcatcttcagatgcaatctttctaatgggtatt
tataacttacctccaatatgtattggatatataattggtggtttaattatgaagaagttc
aagattactgtcaaacaagctgcccacataggatgttggttatccttacttgagtatctt
ctctattttttatcttttctcatgacttgtgaaaattcttcagttgttggaataaatacc
tcttatgaaggaattccacaagatttatatgtggaaaatgacatctttgctgattgcaat
gtggattgcaactgtccatctaaaatatgggatcctgtgtgtggaaacaatggcttgtca
tatctgtcagcttgtcttgctggttgtgagacatccattggaacgggaataaacatggtg
ttccaaaattgcagctgtattcaaacatcaggaaattcatctgcagttcttgggctgtgc
gacaaaggacctgactgttccttgatgctccagtacttcctaatcttgtcagcgatgagc
agtttcatttattctttggctgccatacctggatatatggttctcttgaggtgtatgaaa
tctgaagagaagtcccttggtgtgggattacatacattttgcacaagagtatttgctggc
attcctgcacctatatattttggcgctttaatggattccacatgtttacactggggaact
ttgaaatgtggtgagtcaggggcatgcaggatatatgattccaccaccttcagatacatc
tacctcggattgccggcagcactaagaggatcaagctttgttccagccttaatcatctta
attcttttgaggaagtgtcatctacctggtgaaaatgcctcttcaggaacagagcttata
gagacaaaagtcaaagggaaggaaaatgagtgcaaagatatataccaaaagtccacggtt
ttgaaagatgatgaattgaaaactaaattgtaa

DBGET integrated database retrieval system