KEGG   Homo sapiens (human): 11264
Entry
11264             CDS       T01001                                 

Gene name
PXMP4, PMP24
Definition
(RefSeq) peroxisomal membrane protein 4
  KO
K13350  peroxisomal membrane protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    11264 (PXMP4)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 11264
NCBI-ProteinID: NP_009169
OMIM: 616397
HGNC: 15920
Ensembl: ENSG00000101417
Vega: OTTHUMG00000032273
Pharos: Q9Y6I8(Tdark)
UniProt: Q9Y6I8
LinkDB
Position
20q11.22
AA seq 212 aa
MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSL
QEKLWAILQATYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENN
NINSQINMYLLSRVLFALSRLAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQP
SLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcagccccgccgcagctaagggctctgctcgtagtcgtcaacgcactgctgcgcaag
cgccgctaccacgctgcgttggccgtgcttaagggcttccggaacggggctgtctatgga
gccaaaatccgggcccctcacgcgctggtcatgacctttctcttccggaatggcagcctc
caggagaagctgtgggccatactgcaggccacatatatccactcctggaacctggcacgg
tttgtgttcacctacaagggtctccgtgccctgcagtcctacatacaaggcaagacctac
ccagcacacgcattcctggcggccttcctcgggggtatcctggtgtttggagaaaacaat
aacatcaacagccagatcaacatgtacctgttgtcacgcgtcctgtttgccctgagccgc
ctggctgtagagaagggctacatccctgaacccaggtgggacccgttcccgctgctcact
gcggtggtgtgggggctggtgctgtggctctttgagtatcaccgatccaccctgcagccc
tcgctgcagtcctccatgacctacctctatgaggacagcaatgtatggcacgacatctca
gacttcctcgtctataacaagagccgtccctccaattaa

DBGET integrated database retrieval system