KEGG   Homo sapiens (human): 11343
Entry
11343             CDS       T01001                                 

Gene name
MGLL, HU-K5, HUK5, MAGL, MGL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04923  Regulation of lipolysis in adipocytes
Module
hsa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    11343 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    11343 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    11343 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    11343 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11343 (MGLL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     11343 (MGLL)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   11343 (MGLL)
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase Abhydrolase_2 DUF1057 BAAT_C DUF1350 Esterase_PHB
Other DBs
NCBI-GeneID: 11343
NCBI-ProteinID: NP_001003794
OMIM: 609699
HGNC: 17038
Ensembl: ENSG00000074416
Vega: OTTHUMG00000159641
Pharos: Q99685(Tchem)
UniProt: Q99685
LinkDB
Structure
PDB: 

Position
3q21.3
AA seq 303 aa
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
NT seq 912 nt   +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcattccctaccaggacctccct
cacctggtcaatgcagacggacagtacctcttctgcaggtactggaaacccacaggcaca
cccaaggccctcatctttgtgtcccatggagccggagagcacagtggccgctatgaagag
ctggctcggatgctgatggggctggacctgctggtgttcgcccacgaccatgttggccac
ggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcgtcagggatgtg
ttgcagcatgtggattccatgcagaaagactaccctgggcttcctgtcttccttctgggc
cactccatgggaggcgccatcgccatcctcacggccgcagagaggccgggccacttcgcc
ggcatggtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaag
gtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgac
tccagcgtgctctctcggaataagacagaggtcgacatttataactcagaccccctgatc
tgccgggcagggctgaaggtgtgcttcggcatccaactgctgaatgccgtctcacgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgatcgc
ctatgtgacagcaaaggggcctacctgctcatggagttagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcctgaagtcaccaac
tccgtcttccatgaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcg
tccccaccctga

DBGET integrated database retrieval system