KEGG   Homo sapiens (human): 1325
Entry
1325              CDS       T01001                                 

Gene name
CORT, CST-14, CST-17, CST-29, SST2
Definition
(RefSeq) cortistatin
  KO
K05238  cortistatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1325 (CORT)
SSDB
Motif
Pfam: Somatostatin
Other DBs
NCBI-GeneID: 1325
NCBI-ProteinID: NP_001293
OMIM: 602784
HGNC: 2257
Ensembl: ENSG00000241563
Vega: OTTHUMG00000001906
Pharos: O00230(Tbio)
CPD: C16023 C16024
UniProt: O00230 Q8IUV6
LinkDB
Position
1p36.22
AA seq 105 aa
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA
SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgccattgtcccccggcctcctgctgctgctgctctccggggccacggccaccgctgcc
ctgcccctggagggtggccccaccggccgagacagcgagcatatgcaggaagcggcagga
ataaggaaaagcagcctcctgactttcctcgcttggtggtttgagtggacctcccaggcc
agtgccgggcccctcataggagaggaagcccgggaggtggccaggcggcaggaaggcgca
cccccccagcaatctgcgcgccgggacagaatgccctgcaggaacttcttctggaagacc
ttctcctcctgcaaataa

KEGG   Homo sapiens (human): 6750
Entry
6750              CDS       T01001                                 

Gene name
SST, SMST
Definition
(RefSeq) somatostatin
  KO
K05237  somatostatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    6750 (SST)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6750 (SST)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6750 (SST)
  09154 Digestive system
   04971 Gastric acid secretion
    6750 (SST)
SSDB
Motif
Pfam: Somatostatin
Other DBs
NCBI-GeneID: 6750
NCBI-ProteinID: NP_001039
OMIM: 182450
HGNC: 11329
Ensembl: ENSG00000157005
Vega: OTTHUMG00000156462
Pharos: P61278(Tbio)
CPD: C16021 C16022
UniProt: P61278
LinkDB
Position
3q27.3
AA seq 116 aa
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgctgtcctgccgcctccagtgcgcgctggctgcgctgtccatcgtcctggccctgggc
tgtgtcaccggcgctccctcggaccccagactccgtcagtttctgcagaagtccctggct
gctgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc
aaccagacggagaatgatgccctggaacctgaagatctgtcccaggctgctgagcaggat
gaaatgaggcttgagctgcagagatctgctaactcaaacccggctatggcaccccgagaa
cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system