KEGG   Homo sapiens (human): 1448Help
Entry
1448              CDS       T01001                                 

Gene name
CSN3, CNS10, CSN10, CSNK, KCA
Definition
(RefSeq) casein kappa
  KO
K17282  kappa-casein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1448 (CSN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1448 (CSN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Casein_kappa
Motif
Other DBs
NCBI-GeneID: 1448
NCBI-ProteinID: NP_005203
OMIM: 601695
HGNC: 2446
Ensembl: ENSG00000171209
Vega: OTTHUMG00000129399
Pharos: P07498(Tbio)
UniProt: P07498
LinkDB All DBs
Position
4q13.3
AA seq 182 aa AA seqDB search
MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGT
NLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAI
PPKKIQDKIIIPTINTIATVEPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPP
TA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttttcttctagttgtcaatgccctggcattaaccctgccttttttggctgtg
gaggttcaaaaccagaaacaaccagcatgccatgagaatgatgaaagaccattctatcag
aaaacagctccatatgtcccaatgtattatgtgccaaatagctatccttattatggaacc
aatttgtaccaacgtagaccagctatagcaattaataatccatatgtgcctcgcacatat
tatgcaaacccagctgtagttaggccacatgcccaaattcctcagcggcaatacctgcca
aatagccacccacccactgtggtacgtcgcccaaacctgcatccatcatttattgccatc
cccccaaagaaaattcaggataaaataatcatccctaccatcaataccattgctactgtt
gaacctacaccagctcctgccactgaaccaacggtggacagtgtagtcactccagaagct
ttttcagagtccatcatcacgagcacccctgagacaaccacagttgcagttactccacct
acggcataa

DBGET integrated database retrieval system