KEGG   Homo sapiens (human): 1468
Entry
1468              CDS       T01001                                 

Gene name
SLC25A10, DIC, MTDPS19
Definition
(RefSeq) solute carrier family 25 member 10
  KO
K13577  solute carrier family 25 (mitochondrial dicarboxylate transporter), member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    1468 (SLC25A10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    1468 (SLC25A10)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   1468 (SLC25A10)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 1468
NCBI-ProteinID: NP_036272
OMIM: 606794
HGNC: 10980
Ensembl: ENSG00000183048
Vega: OTTHUMG00000178173
Pharos: Q9UBX3(Tbio)
UniProt: Q9UBX3 A0A0S2Z382
LinkDB
Position
17q25.3
AA seq 287 aa
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL
YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA
DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS
CYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC
AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS
NT seq 864 nt   +upstreamnt  +downstreamnt
atggcagccgaggcgcgcgtgtcgcgctggtacttcggggggctggcctcctgcggggcc
gcctgctgcacgcacccgctggacctgctcaaggtgcatctgcagacgcagcaggaggtg
aagctgcgcatgacgggcatggcgctgcgggtggtgcgtaccgacggcatcctggcactc
tacagcggcctgagcgcctcgctgtgcagacagatgacctactccctgactcggttcgcc
atctacgagactgtgcgggaccgtgtggccaagggcagccaggggcctctccccttccac
gagaaggtgttgctgggctccgtcagcggtttagctggaggcttcgtggggacgcccgca
gacttggtcaacgtcaggatgcagaacgacgtgaagctgccccagggtcagcggcgcaac
tacgcccatgcgctggatggcctgtaccgcgtagctcgtgaagagggtctcaggagactg
ttctcgggtgcaaccatggcatccagccgaggggccttagtcactgtgggccagctgtcc
tgctacgaccaggccaagcagctggtccttagcaccgggtacctctctgacaacatcttc
actcactttgtcgccagctttattgcaggtggatgtgccacgttcctgtgccagcccctg
gatgtgctgaagactcgcctgatgaactccaagggggagtatcagggcgttttccactgc
gccgtggagacagcgaagctcgggcctctggccttttacaagggcctcgtcccagctggc
atccgcctcatcccccacaccgtgctcacttttgtgtttctggaacagctacgcaaaaac
tttggcatcaaagtgccatcctga

DBGET integrated database retrieval system