KEGG   Homo sapiens (human): 1759Help
Entry
1759              CDS       T01001                                 

Gene name
DNM1, DNM, EIEE31
Definition
(RefSeq) dynamin 1
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05100  Bacterial invasion of epithelial cells
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    1759 (DNM1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1759 (DNM1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1759 (DNM1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1759 (DNM1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1759 (DNM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1759 (DNM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1759 (DNM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     1759 (DNM1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    1759 (DNM1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    1759 (DNM1)
   RhoA-dependent endocytosis
    1759 (DNM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1759 (DNM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 AAA_28 PH_11
Motif
Other DBs
NCBI-GeneID: 1759
NCBI-ProteinID: NP_001275668
OMIM: 602377
HGNC: 2972
Ensembl: ENSG00000106976
Vega: OTTHUMG00000020733
Pharos: Q05193(Tbio)
UniProt: Q05193
LinkDB All DBs
Structure
PDB: 

Position
9q34.11
AA seq 864 aa AA seqDB search
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKL
KEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRSGQASPSRPESPRPPFDL
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcggcatggaagatctcatcccgctggtcaaccggctgcaagacgccttc
tctgccatcggccagaacgcggacctcgacctgccgcagatcgctgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaatttcgtaggcagggacttcttgcctcgagga
tctggcattgtcacccgacgtcccctggtcttgcagctggtcaatgcaaccacagaatat
gccgagttcctgcactgcaagggaaagaaattcaccgacttcgaggaggtgcgccttgag
atcgaggccgagaccgacagggtcaccggcaccaacaagggcatctcgccggtgcctatc
aacctccgcgtctactcgccgcacgtgctgaacctgaccctggtggacctgcccggaatg
accaaggtcccggtgggggaccaacctcccgacatcgagttccagatccgagacatgctt
atgcagtttgtcaccaaggagaactgcctcatcctggccgtgtcccccgccaactctgac
ctggccaattctgacgccctcaaggtcgccaaggaggtggacccccagggccagcgcacc
atcggggtcatcaccaagctggacctgatggacgagggcacagatgcccgtgatgtgctg
gagaacaagctgctccccctgcgcagaggctacattggagtggtgaaccggagccagaag
gacattgatggcaagaaggacattaccgccgccttggctgctgaacgaaagttcttcctc
tcccatccatcttatcgccacttggctgaccgtatgggcacgccctacctgcagaaggtc
ctcaatcagcaactgacgaaccacatccgggacacactgccggggctgcggaacaagctg
cagagccagctactgtccattgagaaggaggtggaggaatacaagaacttccgccctgat
gacccagctcgcaagaccaaggccctgctgcagatggtccagcagttcgccgtagacttt
gagaagcgcattgagggctcaggagatcagatcgacacctacgaactgtcagggggagcc
cgcattaaccgaatcttccacgagcgcttccctttcgagctggtcaagatggagtttgat
gagaaggaactccgaagggagatcagctatgctatcaagaatatccatggcattaggacg
ggcctcttcacacctgacctcgcttttgaagccacagtgaaaaagcaggtgcagaagctc
aaagagcccagtatcaagtgtgtggatatggtagtcagtgagctcacagccaccatcaga
aagtgtagcgaaaagctccagcagtacccgcggctacgggaggagatggagcgcatcgtg
accacccacatccgggagcgcgagggccgcactaaggagcaggtcatgcttctcatcgat
atcgagctggcttacatgaacaccaaccatgaggacttcataggctttgccaatgctcag
cagaggagcaaccagatgaacaagaagaagacttcagggaaccaggatgagattctggtc
atccgcaagggctggctgactatcaataatattggcatcatgaaagggggctccaaggag
tactggtttgtgctgactgctgagaatctgtcctggtacaaggatgatgaggagaaagag
aagaaatacatgctgtctgtggacaacctcaagctgcgggacgtggagaagggctttatg
tcgagcaagcatatctttgccctctttaacacggagcagaggaatgtctacaaggattat
cggcagctggagctagcctgtgagacacaggaggaggtggacagctggaaggcctccttc
ctgagggctggcgtgtaccctgagcgtgttggggacaaagagaaagccagcgagaccgag
gagaatggctccgacagcttcatgcattccatggacccacagctggaacggcaagtggag
accatccggaatcttgtggactcatacatggccattgtcaacaagaccgtgagggacctc
atgcccaagaccatcatgcacctcatgattaacaataccaaggagttcatcttctcggag
ctgctggccaacctgtactcgtgtggggaccagaacacgctgatggaggagtcggcggag
caggcacagcggcgcgacgagatgctgcgcatgtaccacgcactgaaggaggcgctcagc
atcatcggcgacatcaacacgaccaccgtcagcacgcccatgcccccgcccgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcgcccacgtccagccccacg
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctgggtccgccctggggggggcgccccccgtgccctccaggccgggg
gcttcccctgaccctttcggccctccccctcaggtgccctcgcgccccaaccgcgccccg
cccggggtccccagccgatcgggtcaggcaagtccatcccgtcctgagagccccaggccc
cccttcgacctctaa

KEGG   Homo sapiens (human): 1785Help
Entry
1785              CDS       T01001                                 

Gene name
DNM2, CMT2M, CMTDI1, CMTDIB, DI-CMTB, DYN2, DYNII, LCCS5
Definition
(RefSeq) dynamin 2
  KO
K23484  dynamin 2 [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05100  Bacterial invasion of epithelial cells
Disease
H00264  Charcot-Marie-Tooth disease
H00700  Centronuclear myopathy
H00865  Lethal congenital contractural syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    1785 (DNM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1785 (DNM2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    1785 (DNM2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1785 (DNM2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1785 (DNM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1785 (DNM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1785 (DNM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     1785 (DNM2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    1785 (DNM2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    1785 (DNM2)
   RhoA-dependent endocytosis
    1785 (DNM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 AAA_28 PH_11
Motif
Other DBs
NCBI-GeneID: 1785
NCBI-ProteinID: NP_001005360
OMIM: 602378
HGNC: 2974
Ensembl: ENSG00000079805
Vega: OTTHUMG00000180694
Pharos: P50570(Tchem)
UniProt: P50570
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 870 aa AA seqDB search
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLV
DSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRD
DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGR
PPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPP
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcgggatggaagagctgatcccgctggtcaacaaactgcaggacgccttc
agctccatcggccagagctgccacctggacctgccgcagatcgctgtagtgggcggccag
agcgccggcaagagctcggtgctggagaacttcgtgggccgggacttccttccccgcggt
tcaggaatcgtcacccggcggcctctcattctgcagctcatcttctcaaaaacagaacat
gccgagtttttgcactgcaagtccaaaaagtttacagactttgatgaagtccggcaggag
attgaagcagagaccgacagggtcacggggaccaacaaaggcatctccccagtgcccatc
aaccttcgagtctactcgccacacgtgttgaacttgaccctcatcgacctcccgggtatc
accaaggtgcctgtgggcgaccagcctccagacatcgagtaccagatcaaggacatgatc
ctgcagttcatcagccgggagagcagcctcattctggctgtcacgcccgccaacatggac
ctggccaactccgacgccctcaagctggccaaggaagtcgatccccaaggcctacggacc
atcggtgtcatcaccaagcttgacctgatggacgagggcaccgacgccagggacgtcttg
gagaacaagttgctcccgttgagaagaggctacattggcgtggtgaaccgcagccagaag
gatattgagggcaagaaggacatccgtgcagcactggcagctgagaggaagttcttcctc
tcccacccggcctaccggcacatggccgaccgcatgggcacgccacatctgcagaagacg
ctgaatcagcaactgaccaaccacatccgggagtcgctgccggccctacgtagcaaacta
cagagccagctgctgtccctggagaaggaggtggaggagtacaagaactttcggcccgac
gaccccacccgcaaaaccaaagccctgctgcagatggtccagcagtttggggtggatttt
gagaagaggatcgagggctcaggagatcaggtggacactctggagctctccgggggcgcc
cgaatcaatcgcatcttccacgagcggttcccatttgagctggtgaagatggagtttgac
gagaaggacttacgacgggagatcagctatgccattaagaacatccatggagtcaggacc
gggcttttcaccccggacttggcattcgaggccattgtgaaaaagcaggtcgtcaagctg
aaagagccctgtctgaaatgtgtcgacctggttatccaggagctaatcaatacagttagg
cagtgtaccagtaagctcagttcctacccccggttgcgagaggagacagagcgaatcgtc
accacttacatccgggaacgggaggggagaacgaaggaccagattcttctgctgatcgac
attgagcagtcctacatcaacacgaaccatgaggacttcatcgggtttgccaatgcccag
cagaggagcacgcagctgaacaagaagagagccatccccaatcagggggagatcctggtg
atccgcaggggctggctgaccatcaacaacatcagcctgatgaaaggcggctccaaggag
tactggtttgtgctgactgccgagtcactgtcctggtacaaggatgaggaggagaaagag
aagaagtacatgctgcctctggacaacctcaagatccgtgatgtggagaagggcttcatg
tccaacaagcacgtcttcgccatcttcaacacggagcagagaaacgtctacaaggacctg
cggcagatcgagctggcctgtgactcccaggaagacgtggacagctggaaggcctcgttc
ctccgagctggcgtctaccccgagaaggaccaggcagaaaacgaggatggggcccaggag
aacaccttctccatggacccccaactggagcggcaggtggagaccattcgcaacctggtg
gactcatacgtggccatcatcaacaagtccatccgcgacctcatgccaaagaccatcatg
cacctcatgatcaacaatacgaaggccttcatccaccacgagctgctggcctacctatac
tcctcggcagaccagagcagcctcatggaggagtcggctgaccaggcacagcggcgggac
gacatgctgcgcatgtaccatgccctcaaggaggcgctcaacatcatcggtgacatcagc
accagcactgtgtccacgcctgtacccccgcctgtcgatgacacctggctccagagcgcc
agcagccacagccccactccacagcgccgaccggtgtccagcatacacccccctggccgg
cccccagcagtgaggggccccactccagggccccccctgattcctgttcccgtgggggca
gcagcctccttctcggcgcccccaatcccatcccggcctggaccccagagcgtgtttgcc
aacagtgacctcttcccagccccgcctcagatcccatctcggccagttcggatcccccca
gggattcccccaggagtgcccagcagaagaccccctgctgcgcccagccggcccaccatt
atccgcccagccgagccatccctgctcgactag

KEGG   Homo sapiens (human): 26052Help
Entry
26052             CDS       T01001                                 

Gene name
DNM3, Dyna_III
Definition
(RefSeq) dynamin 3
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    26052 (DNM3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    26052 (DNM3)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    26052 (DNM3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    26052 (DNM3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    26052 (DNM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26052 (DNM3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    26052 (DNM3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     26052 (DNM3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    26052 (DNM3)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    26052 (DNM3)
   RhoA-dependent endocytosis
    26052 (DNM3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   26052 (DNM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 TetR_C_27
Motif
Other DBs
NCBI-GeneID: 26052
NCBI-ProteinID: NP_056384
OMIM: 611445
HGNC: 29125
Ensembl: ENSG00000197959
Vega: OTTHUMG00000034913
Pharos: Q9UQ16(Tbio)
UniProt: Q9UQ16
LinkDB All DBs
Structure
PDB: 

Position
1q24.3
AA seq 863 aa AA seqDB search
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQVIRKGWLTISNIGIMKGGSKGYWFV
LTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQRNVYKDYRFLE
LACDSQEDVDSWKASLLRAGVYPDKSVGNNKAENDENGQAENFSMDPQLERQVETIRNLV
DSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRD
EMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPL
ARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTRAPPSVP
SRRPPPSPTRPTIIRPLESSLLD
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgggagatggaggagctgatcccgctggtgaaccgtctgcaggacgcgttt
tcggcgctgggacagagctgcctgctggagctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaacttcgtgggcagggactttctccctcgaggg
tcgggcattgtaacaagacgacctcttgtgctgcagcttgttacttctaaagcagaatat
gccgagtttctacattgcaaaggaaagaaatttacagattttgatgaagttcgccttgag
attgaagcagaaacagatcgcgtgactggaatgaataaaggcatttcctccatacccatt
aatttacgagtctattccccacacgtgttaaatctaacccttattgatctacctggaata
actaaagtgcctgtgggagatcagccaccagatatcgagtatcagatcagagaaatgatt
atgcagttcatcacgagggagaactgtctgattttagctgttactccagccaacactgat
cttgcaaactcagatgcgctgaagctagctaaagaagttgatcctcaaggtctgagaacc
attggagttatcaccaaactggaccttatggatgaaggaacggatgccagggatgttcta
gagaacaaactgttgcctcttcgcaggggttacgtgggggtggtaaacagaagccagaag
gacatagatgggaagaaggacataaaggcagccatgctggcagagaggaagtttttcctt
tcccacccggcttacagacatatcgctgaccgaatgggaaccccacacctgcagaaggtc
cttaatcagcaacttaccaaccacattcgggataccctaccaaacttcaggaacaaacta
cagggacagttgctctccatagaacatgaagtagaagcctacaaaaatttcaaaccagaa
gacccaacaaggaagaccaaagcattgctgcagatggttcagcaatttgctgtggacttt
gagaagagaattgaagggtcaggggatcaagtagataccctggaactctcaggtggtgct
aaaatcaatcgtatttttcatgaacgctttccttttgagatagtaaagatggagttcaat
gagaaagaattgcgaagagaaataagctatgcaatcaaaaacatacatggtatcaggaca
gggttgtttactccagacatggcatttgaagcgatagtcaagaaacagattgtaaagttg
aaagggccttccttgaagagtgtggatctggtaatacaagaattaatcaacactgtgaag
aagtgtaccaaaaaactggcaaacttccccagactctgcgaggaaacggaaaggattgtt
gctaaccacattcgtgagcgagaagggaagacaaaggaccaggtattgctattgattgac
attcaagtctcttacatcaacaccaaccatgaagacttcattggcttcgcaaatgctcag
cagaggagcagtcaggttcacaagaaaaccacagttggaaatcaggtgattcgcaagggg
tggctcaccatcagcaacattggcatcatgaaaggcggctcgaagggatactggttcgtc
cttactgcggaaagcttgtcctggtataaagatgatgaggaaaaagaaaagaagtacatg
cttcccttggacaacctgaaagttcgggatgtggaaaagagctttatgtctagcaagcac
atctttgcactctttaatacagagcaaaggaatgtatacaaagactatcgcttccttgag
ctggcatgtgattcccaggaggatgtcgacagctggaaggcatctctactaagagctggg
gtctatcctgacaaatctgtagggaacaacaaagctgaaaatgatgagaatggacaagca
gaaaacttttccatggacccacaattggagaggcaagtggagaccattcgcaacctcgta
gactcctacatgtccattatcaacaaatgtatccgagatctaattccaaaaacaataatg
caccttatgatcaataacgttaaagatttcataaattccgagctcctagcacagttgtat
tcttcagaggaccaaaataccctgatggaggaatctgctgagcaggctcagcgccgggat
gagatgcttcgaatgtatcaagcactgaaagaagcccttgggataattggggacatcagc
acagccaccgtgtccactccggcaccccctccagtggatgactcctggatacagcactct
cgcaggtcacctcctccaagccccacaacccaaaggaggccaacactaagtgctcccctc
gcaaggcccacatccggccgaggaccagctcctgccattccctctcctggcccccactct
ggggctcctccagtcccattccgtccaggcccattacctcctttccccagcagcagtgac
tccttcggagcccctccacaagttccatctaggcctacgagggccccgcccagtgtccca
agccggagaccacccccatcaccaactcgtcccactataatccgcccactagaatcctcc
ctgttagactaa

DBGET integrated database retrieval system