KEGG   Homo sapiens (human): 1908
Entry
1908              CDS       T01001                                 

Gene name
EDN3, ET-3, ET3, HSCR4, PPET3, WS4B
Definition
(RefSeq) endothelin 3
  KO
K05227  endothelin-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa04924  Renin secretion
Disease
H00759  Waardenburg syndrome
H00910  Hirschsprung disease
H00916  Congenital central hypoventilation syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1908 (EDN3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1908 (EDN3)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1908 (EDN3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    1908 (EDN3)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 1908
NCBI-ProteinID: NP_996917
OMIM: 131242
HGNC: 3178
Ensembl: ENSG00000124205
Vega: OTTHUMG00000032867
Pharos: P14138(Tbio)
CPD: C16013
UniProt: P14138
LinkDB
Structure
PDB: 
6IGK

Position
20q13.32
AA seq 238 aa
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAG
PGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINT
PEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVS
SNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
NT seq 717 nt   +upstreamnt  +downstreamnt
atggagccggggctgtggctccttttcgggctcacagtgacctccgccgcaggattcgtg
ccttgctcccagtctggggatgctggcaggcgcggcgtgtcccaggcccccactgcagcc
agatctgagggggactgtgaagagactgtggctggccctggcgaggagactgtggctggc
cctggcgaggggactgtggccccgacagcactgcagggtccaagccctggaagccctggg
caggagcaggcggccgagggggcccctgagcaccaccgatccaggcgctgcacgtgcttc
acctacaaggacaaggagtgtgtctactattgccacctggacatcatttggatcaacact
cccgaacagacggtgccctatggactgtccaactacagaggaagcttccggggcaagagg
tctgcggggccacttccagggaatctgcagctctcacatcggccacacttgcgctgcgct
tgtgtggggagatatgacaaggcctgcctgcacttttgcacccaaactctggacgtcagc
agtaattcaaggacggcagaaaaaacagacaaagaagaggaagggaaggttgaagtcaag
gaccaacaaagcaagcaggctttagacctccaccatccaaagctcatgcccggcagtgga
ctcgccctcgctccatctacctgcccccgctgcctctttcaggaaggagccccttag

DBGET integrated database retrieval system