KEGG   Homo sapiens (human): 200186Help
Entry
200186            CDS       T01001                                 

Gene name
CRTC2, TORC-2, TORC2
Definition
(RefSeq) CREB regulated transcription coactivator 2
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    200186 (CRTC2)
   04152 AMPK signaling pathway
    200186 (CRTC2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    200186 (CRTC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    200186 (CRTC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    200186 (CRTC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TORC_M TORC_C TORC_N
Motif
Other DBs
NCBI-GeneID: 200186
NCBI-ProteinID: NP_859066
OMIM: 608972
HGNC: 27301
Ensembl: ENSG00000160741
Vega: OTTHUMG00000037156
Pharos: Q53ET0(Tbio)
UniProt: Q53ET0
LinkDB All DBs
Structure
PDB: 

Position
1q21.3
AA seq 693 aa AA seqDB search
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTD
QRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPS
GHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRM
EPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtcgggggcgaacgggcctggttcggccacggcctcggcttccaatccgcgc
aaatttagtgagaagattgcgctgcagaagcagcgtcaggccgaggagacggcggccttc
gaggaggtgatgatggacatcggctccacccggttacaggcccaaaaactgcgactggca
tacacaaggagctctcattatggtgggtctctgcccaatgttaaccagattggctctggc
ctggccgagttccagagccccctccactcacctttggattcatctcggagcactcggcac
catgggctggtggaacgggtgcagcgagatcctcgaagaatggtgtccccacttcgccga
tacacccgccacattgacagctctccctatagtcctgcctacttatctcctcccccagag
tctagctggcgaaggacgatggcctggggcaatttccctgcagagaaggggcagttgttt
cgactaccatctgcacttaacaggacaagctctgactctgcccttcatacaagtgtgatg
aaccccagtccccaggatacctacccaggccccacacctcccagcatcctgcccagccga
cgtgggggtattctggatggtgaaatggaccccaaagtacctgctattgaggagaacttg
ctagatgacaagcatttgctgaagccatgggatgctaagaagctatcctcatcctcttcc
cgacctcggtcctgtgaagtccctggaattaacatctttccatctcctgaccagcctgcc
aatgtgcctgtcctcccacctgccatgaacacggggggctccctacctgacctcaccaac
ctgcactttcccccaccactgcccacccccctggaccctgaagagacagcctaccctagc
ctgagtgggggcaacagtacctccaatttgacccacaccatgactcacctgggcatcagc
aggggcatgggcctgggcccaggctatgatgcaccaggacttcattcacctctcagccac
ccatccctgcagtcctccctaagcaatcccaacctccaggcttccctgagcagtcctcag
ccccagcttcagggctcccacagccacccctctctgcctgcctcctccttggcccgccat
gtactgcccaccacctccctgggccacccctcactcagtgctccggctctctcctcctcc
tcttcctcctcctccacttcatctcctgttttgggcgccccctcttaccctgcttctacc
cctggggcctccccccaccaccgccgtgtgcccctcagccccctgagtttgctcgcgggc
ccagccgacgccagaaggtcccaacagcagctgcccaaacagttttcgccaacaatgtca
cccaccttgtcttccatcactcagggcgtccccctggataccagtaaactgtccactgac
cagcggttacccccatacccatacagctccccaagtctggttctgcctacccagccccac
accccaaagtctctacagcagccagggctgccctctcagtcttgttcagtgcagtcctca
ggtgggcagcccccaggcaggcagtctcattatgggacaccgtacccacctgggcccagt
gggcatgggcaacagtcttaccaccggccaatgagtgacttcaacctggggaatctggag
cagttcagcatggagagcccatcagccagcctggtgctggatccccctggcttttctgaa
gggcctggatttttagggggtgaggggccaatgggtggcccccaggatccccacaccttc
aaccaccagaacttgacccactgttcccgccatggctcagggcctaacatcatcctcaca
ggggactcctctccaggtttctctaaggagattgcagcagccctggccggagtgcctggc
tttgaggtgtcagcagctggattggagctagggcttgggctagaagatgagctgcgcatg
gagccactgggcctggaagggctaaacatgctgagtgacccctgtgccctgctgcctgat
cctgctgtggaggagtcattccgcagtgaccggctccaatga

KEGG   Homo sapiens (human): 23373Help
Entry
23373             CDS       T01001                                 

Gene name
CRTC1, MAML2, MECT1, Mam-2, TORC-1, TORC1, WAMTP1
Definition
(RefSeq) CREB regulated transcription coactivator 1
  KO
K15309  CREB-regulated transcription coactivator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Disease
H01508  Salivary gland cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    23373 (CRTC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23373 (CRTC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    23373 (CRTC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TORC_M TORC_C TORC_N
Motif
Other DBs
NCBI-GeneID: 23373
NCBI-ProteinID: NP_056136
OMIM: 607536
HGNC: 16062
Ensembl: ENSG00000105662
Vega: OTTHUMG00000183115
Pharos: Q6UUV9(Tbio)
UniProt: Q6UUV9
LinkDB All DBs
Position
19p13.11
AA seq 634 aa AA seqDB search
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQY
YGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLS
VDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRV
LLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATH
NTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTP
GSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGS
QQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS
LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTL
GSVFGDAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGS
HGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDEL
KIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttcgaacaatccgcggaaattcagcgagaagatcgcgctgcacaatcagaag
caggcggaggagacggcggccttcgaggaggtcatgaaggacctgagcctgacgcgggcc
gcgcggctccagctccagaaatcccagtacctgcaactgggccccagccgaggccagtac
tatggcgggtccctgcccaacgtgaaccagatcgggagtggcaccatggacctgcccttc
cagacccccttccaatcctcgggcctggacaccagccggaccacccggcaccatgggctg
gtggacagggtgtaccgggagcgtggccggctcggctccccacaccgccggcccctgtca
gtggacaaacacggacggcaggccgacagctgcccctatggcaccatgtacctctcacca
cccgcggacaccagctggagaaggaccaattctgactccgccctgcaccagagcacaatg
acgcccacgcagccagaatcctttagcagtgggtcccaggacgtgcaccagaaaagagtc
ttactgttaacagtcccaggaatggaagagaccacatcagaggcagacaaaaacctttcc
aagcaagcatgggacaccaagaagacggggtccaggcccaagtcctgtgaggtccccgga
atcaacatcttcccgtctgccgaccaggaaaacactacagccctgatccccgccacccac
aacacaggggggtccctgcccgacctgaccaacatccacttcccctccccgctcccgacc
ccgctggaccccgaggagcccaccttccctgcactgagcagctccagcagcaccggcaac
ctcgcggccaacctgacgcacctgggcatcggtggcgccggccagggaatgagcacacct
ggctcctctccacagcaccgcccagctggcgtcagccccctgtccctgagcacagaggca
aggcgtcagcaggcatcgcccaccctgtccccgctgtcacccatcactcaggctgtagcc
atggacgccctgtctctggagcagcagctgccctacgccttcttcacccaggcgggctcc
cagcagccaccgccgcagccccagcccccgccgcctcctccacccgcgtcccagcagcca
ccacccccgccacccccacaggcgcccgtccgcctgccccctggtggccccctgttgccc
agcgccagcctgactcgtgggccacagccgcccccgcttgcagtcacggtaccgtcctct
ctcccccagtcccccccagagaaccctggccagccatcgatggggatcgacatcgcctcg
gcgccggctctgcagcagtaccgcactagcgccggctccccggccaaccagtctcccacc
tcgccagtctccaatcaaggcttctccccagggagctccccgcaacacacttccaccctg
ggcagcgtgtttggggacgcgtactatgagcagcagatggcggccaggcaggccaatgct
ctgtcccaccagctggagcagttcaacatgatggagaacgccatcagctccagcagcctg
tacagcccgggctccacactcaactactcgcaggcggccatgatgggcctcacgggcagc
cacgggagcctgccggactcgcagcaactgggatacgccagccacagtggcatccccaac
atcatcctcacagtgacaggagagtccccccccagcctctctaaagaactgaccagctct
ctggccggggtcggcgacgtcagcttcgactccgacagccagtttcccctggacgaactc
aagatcgaccccctgaccctcgacggactgcacatgctcaacgaccccgacatggttctg
gccgacccagccaccgaggacaccttccggatggaccgcctgtga

KEGG   Homo sapiens (human): 64784Help
Entry
64784             CDS       T01001                                 

Gene name
CRTC3, TORC-3, TORC3
Definition
(RefSeq) CREB regulated transcription coactivator 3
  KO
K16334  CREB-regulated transcription coactivator 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64784 (CRTC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TORC_M TORC_C TORC_N
Motif
Other DBs
NCBI-GeneID: 64784
NCBI-ProteinID: NP_073606
OMIM: 608986
HGNC: 26148
Ensembl: ENSG00000140577
Vega: OTTHUMG00000172295
Pharos: Q6UUV7(Tbio)
UniProt: Q6UUV7 Q8TEF4
LinkDB All DBs
Position
15q26.1
AA seq 619 aa AA seqDB search
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHG
GSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDG
SAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYG
GGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGR
PRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSM
SVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASAL
HPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQ
SDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSN
CGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSD
SSMGLLDPSVEETFRADRL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcgccgggctcgggcagcgccaacccgcggaagttcagtgagaagatcgcg
ctgcacacgcagagacaggccgaggagacgcgggccttcgagcagctcatgaccgacctc
accctgtcgcgggttcaatttcagaagcttcagcaactgcgccttacacagtaccatgga
ggatccttaccaaatgtgagccagctgcggagcagtgcgtcagagtttcagccgtcattt
caccaagctgataatgttcggggaacccgccatcacgggctggtggagaggccatccagg
aaccgcttccaccccctccaccgaaggtctggggacaagccagggcgacaatttgatggt
agtgcttttggagccaattattcctcacagcctctggatgagagttggccaaggcagcag
cctccttggaaagacgaaaagcatcctgggttcaggctgacatctgcacttaacaggacc
aattctgattctgctcttcacacgagtgctctgagtaccaagccccaggacccctatgga
ggagggggccagtcggcctggcctgccccatacatgggtttctgtgatggtgagaataat
ggacatggggaagtagcatctttccctggcccattgaaagaagagaatctgttaaatgtt
ccgaagccactgccaaaacaactgtgggagaccaaggagattcagtccctgtcaggacgc
cctcgatcctgtgatgttggaggtggcaatgcttttccacataatggtcaaaacctaggc
ctctcacccttcttggggaccttgaacactggagggtcattgccagatctaaccaacctc
cactactcgacacccctgccagcctccctggacaccaccgaccaccactttggcagtatg
agtgtggggaatagtgtgaacaacatcccagctgctatgacccacctgggtataagaagc
tcctctggtctccagagttctcggagtaacccctccatccaagccacgctcaataagact
gtgctttcctcttccttaaataaccacccacagacatctgttcccaacgcatctgctctt
cacccttcgctccgtctgttttcccttagcaacccatctctttccaccacaaacctgagc
ggcccgtctcggcgtcggcagcctcccgtcagccctctcacgctttctcctggccctgaa
gcacatcaaggtttcagcagacagctgtcttcaaccagcccactggccccatatcctacc
tcccagatggtgtcctcagaccgaagccaactttcctttctgcccacagaagctcaagcc
caggtgtcgccgccacccccttaccctgcaccccaggagctcacccagcccctcctgcag
cagccccgcgcccctgaggcccctgcccagcagccccaggcagcctcctcactgccacag
tcagactttcagcttctcccggcccagggctcatctttgaccaacttcttcccagatgtg
ggttttgaccagcagtccatgaggccaggccctgcctttcctcaacaggtgcctctggtg
caacaaggttcccgagaactgcaggactcttttcatttgagaccaagcccgtattccaac
tgcgggagtctcccgaacaccatcctgccagaagactccagcaccagcctgttcaaagac
ctcaacagtgcgctggcaggcctgcctgaggtcagcctgaacgtggacactccatttcca
ctggaagaggagctgcagattgaacccctgagcctggacggactcaacatgttaagtgac
tccagcatgggcctgctggacccctctgttgaagagacgtttcgagctgacagactgtga

DBGET integrated database retrieval system