KEGG   Homo sapiens (human): 2023Help
Entry
2023              CDS       T01001                                 

Gene name
ENO1, ENO1L1, HEL-S-17, MPB1, NNE, PPH
Definition
(RefSeq) enolase 1
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2023 (ENO1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    2023 (ENO1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    2023 (ENO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    2023 (ENO1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2023 (ENO1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     2023 (ENO1)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     2023 (ENO1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2023 (ENO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 2023
NCBI-ProteinID: NP_001419
OMIM: 172430
HGNC: 3350
Ensembl: ENSG00000074800
Vega: OTTHUMG00000001773
Pharos: P06733(Tchem)
UniProt: P06733 A0A024R4F1
LinkDB All DBs
Structure
PDB: 

Position
1p36.23
AA seq 434 aa AA seqDB search
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
GVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
AGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE
AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKV
VIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLA
QANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtctattctcaagatccatgccagggagatctttgactctcgcgggaatcccactgtt
gaggttgatctcttcacctcaaaaggtctcttcagagctgctgtgcccagtggtgcttca
actggtatctatgaggccctagagctccgggacaatgataagactcgctatatggggaag
ggtgtctcaaaggctgttgagcacatcaataaaactattgcgcctgccctggttagcaag
aaactgaacgtcacagaacaagagaagattgacaaactgatgatcgagatggatggaaca
gaaaataaatctaagtttggtgcgaacgccattctgggggtgtcccttgccgtctgcaaa
gctggtgccgttgagaagggggtccccctgtaccgccacatcgctgacttggctggcaac
tctgaagtcatcctgccagtcccggcgttcaatgtcatcaatggcggttctcatgctggc
aacaagctggccatgcaggagttcatgatcctcccagtcggtgcagcaaacttcagggaa
gccatgcgcattggagcagaggtttaccacaacctgaagaatgtcatcaaggagaaatat
gggaaagatgccaccaatgtgggggatgaaggcgggtttgctcccaacatcctggagaat
aaagaaggcctggagctgctgaagactgctattgggaaagctggctacactgataaggtg
gtcatcggcatggacgtagcggcctccgagttcttcaggtctgggaagtatgacctggac
ttcaagtctcccgatgaccccagcaggtacatctcgcctgaccagctggctgacctgtac
aagtccttcatcaaggactacccagtggtgtctatcgaagatccctttgaccaggatgac
tggggagcttggcagaagttcacagccagtgcaggaatccaggtagtgggggatgatctc
acagtgaccaacccaaagaggatcgccaaggccgtgaacgagaagtcctgcaactgcctc
ctgctcaaagtcaaccagattggctccgtgaccgagtctcttcaggcgtgcaagctggcc
caggccaatggttggggcgtcatggtgtctcatcgttcgggggagactgaagataccttc
atcgctgacctggttgtggggctgtgcactgggcagatcaagactggtgccccttgccga
tctgagcgcttggccaagtacaaccagctcctcagaattgaagaggagctgggcagcaag
gctaagtttgccggcaggaacttcagaaaccccttggccaagtaa

KEGG   Homo sapiens (human): 2026Help
Entry
2026              CDS       T01001                                 

Gene name
ENO2, HEL-S-279, NSE
Definition
(RefSeq) enolase 2
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2026 (ENO2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    2026 (ENO2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    2026 (ENO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    2026 (ENO2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2026 (ENO2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     2026 (ENO2)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     2026 (ENO2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2026 (ENO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 2026
NCBI-ProteinID: NP_001966
OMIM: 131360
HGNC: 3353
Ensembl: ENSG00000111674
Vega: OTTHUMG00000168967
Pharos: P09104(Tbio)
UniProt: P09104 Q6FHV6
LinkDB All DBs
Structure
PDB: 

Position
12p13.31
AA seq 434 aa AA seqDB search
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK
AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI
VIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagagaagatctgggcccgggagatcctggactcccgcgggaaccccacagtg
gaggtggatctctatactgccaaaggtcttttccgggctgcagtgcccagtggagcctct
acgggcatctatgaggccctggagctgagggatggagacaaacagcgttacttaggcaaa
ggtgtcctgaaggcagtggaccacatcaactccaccatcgcgccagccctcatcagctca
ggtctctctgtggtggagcaagagaaactggacaacctgatgctggagttggatgggact
gagaacaaatccaagtttggggccaatgccatcctgggtgtgtctctggccgtgtgtaag
gcaggggcagctgagcgggaactgcccctgtatcgccacattgctcagctggccgggaac
tcagacctcatcctgcctgtgccggccttcaacgtgatcaatggtggctctcatgctggc
aacaagctggccatgcaggagttcatgatcctcccagtgggagctgagagctttcgggat
gccatgcgactaggtgcagaggtctaccatacactcaagggagtcatcaaggacaaatac
ggcaaggatgccaccaatgtgggggatgaaggtggctttgcccccaatatcctggagaac
agtgaagccttggagctggtgaaggaagccatcgacaaggctggctacacggaaaagatc
gttattggcatggatgttgctgcctcagagttttatcgtgatggcaaatatgacttggac
ttcaagtctcccactgatccttcccgatacatcactggggaccagctgggggcactctac
caggactttgtcagggactatcctgtggtctccattgaggacccatttgaccaggatgat
tgggctgcctggtccaagttcacagccaatgtagggatccagattgtgggtgatgacctg
acagtgaccaacccaaaacgtattgagcgggcagtggaagaaaaggcctgcaactgtctg
ctgctcaaggtcaaccagatcggctcggtcactgaagccatccaagcgtgcaagctggcc
caggagaatggctggggggtcatggtgagtcatcgctcaggagagactgaggacacattc
attgctgacctggtggtggggctgtgcacaggccagatcaagactggtgccccgtgccgt
tctgaacgtctggctaaatacaaccagctcatgagaattgaggaagagctgggggatgaa
gctcgctttgccggacataacttccgtaatcccagtgtgctgtga

KEGG   Homo sapiens (human): 2027Help
Entry
2027              CDS       T01001                                 

Gene name
ENO3, GSD13, MSE
Definition
(RefSeq) enolase 3
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01953  Glycogen storage disease type XIII
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2027 (ENO3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    2027 (ENO3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    2027 (ENO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    2027 (ENO3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2027 (ENO3)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     2027 (ENO3)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     2027 (ENO3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2027 (ENO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 2027
NCBI-ProteinID: NP_001967
OMIM: 131370
HGNC: 3354
Ensembl: ENSG00000108515
Vega: OTTHUMG00000099394
Pharos: P13929(Tbio)
UniProt: P13929
LinkDB All DBs
Structure
PDB: 

Position
17p13.2
AA seq 434 aa AA seqDB search
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGK
GVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK
AGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKE
AMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKV
VIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDD
WATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLA
QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
AIFAGRKFRNPKAK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcagaaaatctttgcccgggaaatcttggactccaggggcaaccccacggtg
gaggtggacctgcacacggccaagggccgattccgagcagctgtgcccagtggggcttcc
acgggtatctatgaggctctggaactaagagacggagacaaaggccgctacctggggaaa
ggagtcctgaaggctgtggagaacatcaacaatactctgggccctgctctgctgcaaaag
aaactaagcgttgtggatcaagaaaaagttgacaaatttatgattgagctagatgggacc
gagaataagtccaagtttggggccaatgccatcctgggcgtgtccttggccgtgtgtaag
gcgggagcagctgagaagggggtccccctgtaccgccacatcgcagatctcgctgggaac
cctgacctcatactcccagtgccagccttcaatgtgatcaacgggggctcccatgctgga
aacaagctggccatgcaggagttcatgattctgcctgtgggagccagctccttcaaggaa
gccatgcgcattggcgccgaggtctaccaccacctcaagggggtcatcaaggccaagtat
gggaaggatgccaccaatgtgggtgatgaaggtggcttcgcacccaacatcctggagaac
aatgaggccctggagctgctgaagacggccatccaggcggctggttacccagacaaggtg
gtgatcggcatggatgtggcagcatctgagttctatcgcaatgggaagtacgatcttgac
ttcaagtcgcctgatgatcccgcacggcacatcactggggagaagctcggagagctgtat
aagagctttatcaagaactatcctgtggtctccatcgaagacccctttgaccaggatgac
tgggccacttggacctccttcctctcgggggtgaacatccagattgtgggggatgacttg
acagtcaccaaccccaagaggattgcccaggccgttgagaagaaggcctgcaactgtctg
ctgctgaaggtcaaccagatcggctcggtgaccgaatcgatccaggcgtgcaaactggct
cagtctaatggctggggggtgatggtgagccaccgctctggggagactgaggacacattc
attgctgaccttgtggtggggctctgcacaggacagatcaagactggcgccccctgccgc
tcggagcgtctggccaaatacaaccaactcatgaggatcgaggaggctcttggggacaag
gcaatctttgctggacgcaagttccgtaacccgaaggccaagtga

KEGG   Homo sapiens (human): 387712Help
Entry
387712            CDS       T01001                                 

Gene name
ENO4, C10orf134
Definition
(RefSeq) enolase 4
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    387712 (ENO4)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    387712 (ENO4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    387712 (ENO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    387712 (ENO4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    387712 (ENO4)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     387712 (ENO4)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     387712 (ENO4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   387712 (ENO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Enolase_C Enolase_N Porin_2 PRIMA1
Motif
Other DBs
NCBI-GeneID: 387712
NCBI-ProteinID: NP_001229628
OMIM: 131375
HGNC: 31670
Ensembl: ENSG00000188316
UniProt: A6NNW6
LinkDB All DBs
Position
10q25.3
AA seq 625 aa AA seqDB search
MEEEGGGRSCGTTRELQKLKQQAMEYYRENDVPRRLEELLNSTFYLQPADVYGHLANCFS
KLAKPPTICKIVGKDVLDGLGLPTLQVDIFCTIQNFPKNVCSVVISTHFEVHENALPELA
KAEEAERASAVSTAVQWVNSTITHELQGMAPSDQAEVDHLLRIFFASKVQEDKGRKELEK
SLEYSTVPTPLPPVPPPPPPPPPTKKKGQKPGRKDTITEKPIAPAEPVEPVLSGSMAIGA
VSLAVAKACAMLLNKPLYLNIALLKHNQEQPTTLSMPLLMVSLVSCGKSSSGKLNLMKEV
ICIPHPELTTKQGVEMLMEMQKHINKIIEMPSPPKAETKKGHDGSKRGQQQITGKMSHLG
CLTINCDSIEQPLLLIQEICANLGLELGTNLHLAINCAGHELMDYNKGKYEVIMGTYKNA
AEMVDLYVDLINKYPSIIALIDPFRKEDSEQWDSIYHALGSRCYIIAGTASKSISKLLEQ
GNISIPKSNGLIIKHTNQTTMSDLVEITNLIDSKKHITVFGSTEGESSDDSLVDLAVGLG
VRFIKLGGLSRGERVTKYNRLLTIEEELVQNGTLGFKEEHTFFYFNEEAEKAAEALEAAA
AREPLVPTFPTQGVEESAETGASSG
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaaggcggcggccgcagctgtgggaccactagggagctgcagaagctgaag
cagcaggcgatggagtactaccgggagaacgacgttccgcgcaggctggaagagctgctc
aactccaccttctacctccagcctgccgacgtctacgggcacctggcaaactgcttttct
aaacttgcaaagcctcccaccatatgcaaaatagtggggaaagacgtactagatggactg
gggcttccaaccctgcaagtggacatattctgcaccattcaaaactttcccaagaacgta
tgttctgtggtgatctcgactcattttgaagtccatgagaatgctctgcccgagctggcc
aaggcggaggaggcagagagggccagcgcggtgagcaccgccgtgcagtgggtcaacagc
accatcacgcacgagctccaggggatggcaccctctgaccaggcagaggtggatcaccta
ctcaggatattcttcgcaagtaaagtacaagaagataaggggagaaaagaattggaaaag
agcctggaatactcaacagtgcctacacctctacctccagtaccaccaccaccaccccct
ccacctcctaccaaaaaaaaggggcaaaagccagggaggaaggatactattacagagaaa
cctattgcgcctgcagagcctgttgagcctgtactcagtggcagtatggccataggggcc
gtgtcactagctgttgccaaagcctgtgccatgctgcttaataaacctctgtacttaaat
atcgctctactgaagcacaatcaggaacagccaacaacgctatctatgcctttgctgatg
gtatcgctggtcagctgtgggaagtcatcatctgggaagctaaatttaatgaaagaagtg
atttgtataccccatcctgaattaacaaccaaacaaggtgtcgagatgcttatggaaatg
cagaaacatatcaacaaaataattgaaatgccctctcctccaaaagcagagacaaaaaaa
gggcacgatggaagcaaaagaggtcaacagcagatcactggcaagatgtctcatcttggc
tgtttaaccattaactgtgactccatagaacagccactgcttctaatacaggaaatctgt
gccaacctggggctagaactgggaacaaatctgcatctagctatcaactgtgctggacat
gagctgatggactacaataaaggaaagtatgaagtgatcatgggcacatacaaaaatgca
gcggagatggttgacctgtatgtggatctgatcaacaagtacccttcaattattgcctta
attgatcctttcaggaaggaggactctgaacagtgggacagcatctatcacgcacttggt
tccaggtgttacataattgcaggaactgcttccaaaagcatttctaaacttctagagcaa
ggaaacatcagcatccccaaatccaatgggctgatcataaaacacacaaaccaaactaca
atgtctgacttggtggaaataaccaatctgattgacagtaagaagcacatcactgtcttt
ggaagtacagaaggagaatcatctgatgacagccttgtcgatttggctgttgggcttggt
gtccggttcatcaagttggggggtctttcccgtggtgaacgagtgactaaatacaaccgc
cttctcactatagaggaagaacttgtccagaatggaacactgggtttcaaagaagaacac
acttttttttactttaatgaggaagctgaaaaggctgcggaggcacttgaggctgctgcg
gctagggagccgctggtgcccaccttccccacacaaggtgtagaggaatcagccgaaaca
ggagcatcctctggatag

DBGET integrated database retrieval system