KEGG   Homo sapiens (human): 210
Entry
210               CDS       T01001                                 

Gene name
ALAD, ALADH, PBGS
Definition
(RefSeq) aminolevulinate dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
N00602  FECH deficiency in heme biosynthesis
N00603  PPOX deficiency in heme biosynthesis
N00604  CPOX deficiency in heme biosynthesis
N00605  UROD deficiency in heme biosynthesis
N00606  UROS deficiency in heme biosynthesis
N00607  HMBS deficiency in heme biosynthesis
N00608  ALAD deficiency in heme biosynthesis
Disease
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    210 (ALAD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    210 (ALAD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     210 (ALAD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   210 (ALAD)
SSDB
Motif
Pfam: ALAD
Other DBs
NCBI-GeneID: 210
NCBI-ProteinID: NP_000022
OMIM: 125270
HGNC: 395
Ensembl: ENSG00000148218
Vega: OTTHUMG00000020522
Pharos: P13716(Tbio)
UniProt: P13716 Q6ZMU0 A0A140VJL9
LinkDB
Structure
PDB: 
1PV8 5HMS 5HNR 1E51

Position
9q32
AA seq 330 aa
MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKR
LEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACD
VCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE
ALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEAMTAFRRAGADIIITYYTPQLLQWLKEE
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcagccccagtccgttctgcacagcggctacttccacccactacttcgggcctggcag
acagccaccaccaccctcaatgcctccaacctcatctaccccatctttgtcacggatgtt
cctgatgacatacagcctatcaccagcctcccaggagtggccaggtatggtgtgaagcgg
ctggaagagatgctgaggcccttggtggaagagggcctacgctgtgtcttgatctttggc
gtccccagcagagttcccaaggacgagcggggttccgcagctgactccgaggagtcccca
gctattgaggcaatccatctgttgaggaagaccttccccaacctcctggtggcctgtgat
gtctgcctgtgtccctacacctcccatggtcactgcgggctcctgagtgaaaacggagca
ttccgggctgaggagagccgccagcggctggctgaggtggcattggcgtatgccaaggca
ggatgtcaggtggtagccccgtcggacatgatggatggacgcgtggaagccatcaaagag
gccctgatggcacatggacttggcaacagggtatcggtgatgagctacagtgccaaattt
gcttcctgtttctatggccctttccgggatgcagctaagtcaagcccagcttttggggac
cgccgctgctaccagctgccccctggagcacgaggcctggctctccgagctgtggaccgg
gatgtacgggaaggagctgacatgctcatggtgaagccgggaatgccctacctggacatc
gtgcgggaggtaaaggacaagcaccctgacctccctctcgccgtgtaccacgtctctgga
gagtttgccatgctgtggcatggagcccaggccggggcatttgatctcaaggctgccgta
ctggaggccatgactgccttccgcagagcaggtgctgacatcatcatcacctactacaca
ccgcagctgctgcagtggctgaaggaggaatga

DBGET integrated database retrieval system