KEGG   Homo sapiens (human): 2119Help
Entry
2119              CDS       T01001                                 

Gene name
ETV5, ERM
Definition
(RefSeq) ETS variant 5
  KO
K15593  ets translocation variant 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
Disease
H00024  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2119 (ETV5)
  09162 Cancer: specific types
   05215 Prostate cancer
    2119 (ETV5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2119 (ETV5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2119 (ETV5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETS_PEA3_N Ets
Motif
Other DBs
NCBI-GeneID: 2119
NCBI-ProteinID: NP_004445
OMIM: 601600
HGNC: 3494
Ensembl: ENSG00000244405
Vega: OTTHUMG00000156639
Pharos: P41161(Tbio)
UniProt: P41161
LinkDB All DBs
Structure
PDB: 

Position
3q27.2
AA seq 510 aa AA seqDB search
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNY
CAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHS
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNR
PSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
VDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDT
LPLTHFEDSPAYLLDMDRCSSLPYAEGFAY
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggacgggttttatgatcagcaagtcccttttatggtcccagggaaatctcgatctgag
gaatgcagagggcggcctgtgattgacagaaagaggaagtttttggacacagatctggct
cacgattctgaagagctatttcaggatctcagtcaacttcaagaggcttggttagctgaa
gcacaagttcctgatgatgaacagtttgtcccagattttcagtctgataacctggtgctt
catgccccacctccaaccaagatcaaacgggagctgcacagcccctcctctgagctgtcg
tcttgtagccatgagcaggctcttggtgctaactatggagaaaagtgcctctacaactat
tgtgcctatgataggaagcctccctctgggttcaagccattaacccctcctacaaccccc
ctctcacccacccatcagaatcccctatttcccccacctcaggcaactctgcccacctca
gggcatgcccctgcagctggcccagttcaaggtgtgggccccgcccccgccccccattcg
cttccagagcctggaccacagcagcaaacatttgcggtcccccgaccaccacatcagccc
ctgcagatgccaaagatgatgcctgaaaaccagtatccatcagaacagagatttcagaga
caactgtctgaaccctgccaccccttccctcctcagccaggagttcctggagataatcgc
cccagttaccatcggcaaatgtcagaacctattgtccctgcagctcccccgccccctcag
ggattcaaacaagaataccatgacccactctatgaacatggggtcccgggcatgccaggg
cccccagcacacgggttccagtcaccaatgggaatcaagcaggagcctcgggattactgc
gtcgattcagaagtgcctaactgccagtcatcctacatgagagggggttatttctccagc
agccatgaaggtttttcatatgaaaaagatccccgattatactttgacgacacttgtgtt
gtgcctgagagactggaaggcaaagtcaaacaggagcctaccatgtatcgagaggggccc
ccttaccagaggcgaggttcccttcagctgtggcagttcctggtcacccttcttgatgac
ccagccaatgcccacttcattgcctggacaggtcgaggcatggagttcaagctgatagaa
ccggaagaggttgctcggcgctggggcatccagaagaaccggccagccatgaactatgac
aagctgagccgctctctccgctattactatgaaaagggcatcatgcagaaggtggctgga
gagcgatacgtctacaaatttgtctgtgacccagatgccctcttctccatggctttcccg
gataaccagcgtccgttcctgaaggcagagtccgagtgccacctcagcgaggaggacacc
ctgccgctgacccactttgaagacagccccgcttacctcctggacatggaccgctgcagc
agcctcccctatgccgaaggctttgcttactaa

DBGET integrated database retrieval system