KEGG   Homo sapiens (human): 2205
Entry
2205              CDS       T01001                                 

Gene name
FCER1A, FCE1A, FcERI
Definition
(RefSeq) Fc fragment of IgE receptor Ia
  KO
K08089  high affinity immunoglobulin epsilon receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa05310  Asthma
Drug target
Benzylpenicilloyl polylysine: D03095
Omalizumab: D05251
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2205 (FCER1A)
   04071 Sphingolipid signaling pathway
    2205 (FCER1A)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    2205 (FCER1A)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    2205 (FCER1A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 Ig_5 I-set Izumo-Ig Ig_6 C2-set Adeno_E3_CR1 C1-set TadE
Other DBs
NCBI-GeneID: 2205
NCBI-ProteinID: NP_001992
OMIM: 147140
HGNC: 3609
Ensembl: ENSG00000179639
Vega: OTTHUMG00000037176
Pharos: P12319(Tbio)
UniProt: P12319
LinkDB
Structure
PDB: 

Position
1q23.2
AA seq 257 aa
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTR
KGFRLLNPHPKPNPKNN
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctcctgccatggaatcccctactctactgtgtgtagccttactgttcttcgctcca
gatggcgtgttagcagtccctcagaaacctaaggtctccttgaaccctccatggaataga
atatttaaaggagagaatgtgactcttacatgtaatgggaacaatttctttgaagtcagt
tccaccaaatggttccacaatggcagcctttcagaagagacaaattcaagtttgaatatt
gtgaatgccaaatttgaagacagtggagaatacaaatgtcagcaccaacaagttaatgag
agtgaacctgtgtacctggaagtcttcagtgactggctgctccttcaggcctctgctgag
gtggtgatggagggccagcccctcttcctcaggtgccatggttggaggaactgggatgtg
tacaaggtgatctattataaggatggtgaagctctcaagtactggtatgagaaccacaac
atctccattacaaatgccacagttgaagacagtggaacctactactgtacgggcaaagtg
tggcagctggactatgagtctgagcccctcaacattactgtaataaaagctccgcgtgag
aagtactggctacaattttttatcccattgttggtggtgattctgtttgctgtggacaca
ggattatttatctcaactcagcagcaggtcacatttctcttgaagattaagagaaccagg
aaaggcttcagacttctgaacccacatcctaagccaaaccccaaaaacaactga

DBGET integrated database retrieval system