KEGG   Homo sapiens (human): 23513Help
Entry
23513             CDS       T01001                                 

Gene name
SCRIB, CRIB1, SCRB1, SCRIB1, Vartul
Definition
(RefSeq) scribble planar cell polarity protein
  KO
K16175  protein scribble
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06135  Cytoskeletal regulation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00340  The Scribble/Dlg/Lgl polarity module
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    23513 (SCRIB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23513 (SCRIB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    23513 (SCRIB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23513 (SCRIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 LRR_9
Motif
Other DBs
NCBI-GeneID: 23513
NCBI-ProteinID: NP_056171
OMIM: 607733
HGNC: 30377
Ensembl: ENSG00000180900
Vega: OTTHUMG00000165154
Pharos: Q14160(Tbio)
UniProt: Q14160 A0A0G2JNZ2
LinkDB All DBs
Structure
PDB: 

Position
8q24.3
AA seq 1630 aa AA seqDB search
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
RLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKE
EEEEEEGSPQEEEEEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPA
RIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKL
LEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEG
GAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLP
HSSPPTAAVATTSITTATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVG
GSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLR
PCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVS
PTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAAL
EVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQA
YRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLV
GADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSP
TSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRAL
WRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTST
SPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRP
GRRGLGPVPS
NT seq 4893 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtgcatcccgctgtggcgctgcaaccggcacgtggagtcggtggacaagcgg
cactgttcgctgcaggccgtgccggaggagatctaccgctacagccgcagcctggaggag
ctgctgctcgacgccaaccagctgcgcgagctgcccaagccttttttccggctgctgaac
ttgcgcaagctgggcctgagcgacaacgagatccagcggttgcctcccgaggtggccaac
ttcatgcagctggtggagctggacgtgtcccggaacgatatccctgagatcccggagagc
atcaagttctgcaaggctctggagatcgcggacttcagcgggaaccccctctccaggctc
cctgatggcttcactcagctgcgcagcctggctcacctggccctgaatgatgtgtctctg
caggcactgcccggggacgtgggcaacctcgccaacctggtgaccctggagctccgggag
aacctgctcaagtccctgccagcgtccctgtcatttctggtcaagctggaacagctggat
ctgggaggcaacgatctggaagtgctgccagacactctgggggctctgcccaatcttcgg
gagctgtggcttgaccggaaccagctgtcagcactgcccccggagctcgggaacctgcgg
cgcctggtgtgcctggacgtgtcggaaaaccggctggaggagctgcctgctgagctcggc
gggctggtgctgctcactgacctgctgctgtcccagaacctgctgcggaggctgcccgac
ggcatcggtcagctgaagcagctatccatcctaaaggtagaccagaatcggctgtgcgag
gtgaccgaggccatcggggactgtgagaacctctctgagctgatcctcacggagaacctg
ctgatggccctgccccgctccctgggaaagctgactaagctgaccaacctcaacgtggac
cggaaccacctcgaggcgctgccgcccgagatcgggggctgtgtggcactcagcgtcctc
tccttgagggacaaccgcctggccgtcctgccaccagagctggcccacacgacagagctg
cacgtgctggacgtggcggggaaccgcctgcagagtctgccgttcgcgctcacccacctc
aatctcaaggccctgtggctggcagagaaccaggcgcagcccatgctccggttccagacg
gaggatgatgcccggaccggcgagaaggtgctcacctgctacttgctgccccagcagccc
ccacccagcctcgaggatgctgggcagcaggggagcctctcggagacctggagcgatgcc
ccgccgagccgcgtcagcgtcatccagttcctggaggcccccataggtgatgaggacgct
gaggaagctgcagctgagaagcggggcctacagcgccgggccacacctcaccccagcgag
ctcaaggtgatgaagaggagcatcgaggggcggcggagcgaggcctgcccttgccagcca
gactctgggtcgcccttgcctgcagaggaggagaagcggctgagtgccgagtctggcctg
agtgaagactctcgcccatctgccagcacagtctctgaggctgagcccgagggcccgtcg
gctgaggcacagggtgggagccagcaggaagccacgactgctggcggggaggaagacgcc
gaagaggactaccaggagcccacggtgcatttcgcagaggacgcactgctgcccggggat
gacagggagatcgaggaggggcagcctgaggccccctggaccctgccaggcgggaggcag
cggctcatccgcaaggacacacctcactacaaaaagcacttcaagatctccaagctgccc
cagcccgaggccgttgtggctctgctgcagggcatgcagcctgatggggagggccctgtg
gctcccgggggctggcacaatggcccccacgcaccctgggctcctcgggcccagaaggag
gaggaggaggaggaagagggtagtcctcaggaggaggaggaagaggaggaggaggaaaac
agggctgaagaggaagaggccagcactgaggaggaggacaaggagggggccgtggtttct
gcgccctctgtcaagggagtgtcgtttgaccaggccaataacctgctgatagagcctgct
cgcattgaggaggaagagctgaccctcactatcctgcggcagactgggggcctgggcatc
agcattgcgggcggcaagggctccacaccctataagggggacgacgagggcatattcatc
tctcgggtgtccgaggaaggccctgcggcccgggctggagtccgtgtgggtgacaagctc
ctggaggtgaatggtgtggctctgcagggcgccgagcaccacgaggccgtggaggcgctc
cggggggccggcactgccgtgcagatgcgagtgtggcgggagcgcatggtggagcctgag
aacgcggtcaccatcacgccgctgcggcccgaggatgattacagcccccgagagcggcgg
ggaggggggctgcgcctgcccctgctcccgcctgagagccccgggcccctccgtcagcgc
cacgtggcctgcctggcacgcagcgagagggggctgggcttcagcattgctggtgggaaa
ggctccacaccctacagggctggtgatgcgggcatcttcgtctcccgcattgccgagggc
ggtgctgctcaccgcgcgggcacactgcaggttggcgaccgcgtcctctctattaatgga
gtggacgtgactgaggccaggcatgaccacgccgtctccctgctgaccgctgcctccccc
accatcgccctgctgttggagcgggaggctgggggccctcttcctcccagccctctgcca
cattcctcaccccccaccgctgctgttgccaccaccagcataaccactgccacccccggg
gtgcctgggttgccgagcctggcccccagcctgctggctgccgcgttggaagggccatac
ccagtggaggagatccgtctgccaagagctgggggccctctggggcttagtattgtcgga
ggctccgaccattccagccacccgtttggtgtccaggagcctggtgtgttcatctccaag
gtgctcccgcggggcctggccgctcgcagcggcctgcgggttggggaccgcatcctggca
gtgaacgggcaagacgtgcgggatgccacgcaccaagaagcagtcagtgccctgctccgg
ccctgcctggagctgtcgctgctggtgcggagggacccggcacccccgggcctacgggaa
ctgtgcatccagaaggcacctggggagaggctgggcatcagcatccgcgggggtgccagg
ggccacgctggcaacccccgcgaccccacagacgagggcatcttcatctccaaggtgagc
cccacgggggcagccgggcgcgacggtcggctgcgtgtgggtttgcggctgttggaggtg
aaccagcagagcctgctgggcctgacgcacggcgaggcggtgcagctgctccgcagtgtg
ggcgacaccctcaccgtgctggtctgtgacggctttgaggccagcaccgacgcagccctg
gaggtgtccccaggtgtcattgccaacccctttgcggcaggcatcggccaccggaacagc
ctggagagcatctcttccatcgaccgggagctgagccctgagggcccaggcaaggagaag
gagctgcctggacagaccctgcactgggggcccgaggccacagaagccgcaggtcggggt
ctgcagcccctgaagctggactaccgcgccctggccgccgtgcccagcgctggcagcgtg
cagagggtaccgtctggagcagctggagggaagatggctgaatctccctgctcccctagt
ggccagcagccgccctccccgccttctccggatgagctgcccgccaatgtgaagcaggcc
tacagggccttcgcggccgtgcccacttctcacccgcctgaggatgcccctgcccagccc
cccacgcctgggcctgcagcctccccggagcagctgtccttccgggagcggcagaagtac
tttgagctggaggtgcgcgtgccccaggccgagggcccccctaagcgcgtgtccctggtg
ggtgctgacgacctgcggaagatgcaggaggaggaagccagaaaactacagcagaagaga
gcgcagatgctgcgggaggcggcagaggctggggccgaagcgaggctcgccctggacggg
gagacgctgggcgaggaggaacaggaggatgagcagccaccctgggccagcccgagcccc
acctcaaggcagagcccggcgtcccccccacccctgggaggtggcgccccggtgcggacg
gccaaagctgaacggcgccaccaggagcggctgcgcgtgcagagtccggagccaccggca
cccgagcgtgccctgtcccctgccgagctccgggccctggaggccgagaagcgtgcgctg
tggagggcagccaggatgaagtcattggaacaggacgctctccgagcacagatggtcctc
agcaggtcccaggaaggccggggcacgcgggggcccctggagcgactggccgaggcccct
tcccctgcgcccaccccgtcgcccacccctgtggaagacctcggcccccagaccagcacc
tccccgggacgcctgtcaccggactttgctgaggagttgaggtccctggaaccatctccc
agccctggcccgcaggaggaggatggagaagtggctctggtgcttctgggcaggccctca
cccggcgctgtgggccctgaagatgtggcactgtgcagcagccgccgccccgtaaggcct
gggcgccgtggcctgggccctgtgccctcctag

DBGET integrated database retrieval system