KEGG   Homo sapiens (human): 2587
Entry
2587              CDS       T01001                                 

Gene name
GALR1, GALNR, GALNR1
Definition
(RefSeq) galanin receptor 1
  KO
K04230  galanin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2587 (GALR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2587 (GALR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Galanin
    2587 (GALR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srd 7tm_4 Bac_rhodopsin Chitin_synth_1
Other DBs
NCBI-GeneID: 2587
NCBI-ProteinID: NP_001471
OMIM: 600377
HGNC: 4132
Ensembl: ENSG00000166573
Vega: OTTHUMG00000132875
Pharos: P47211(Tchem)
UniProt: P47211
LinkDB
Position
18q23
AA seq 349 aa
MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggagctggcggtcgggaacctcagcgagggcaacgcgagctggccggagccccccgcc
ccggagcccgggccgctgttcggcatcggcgtggagaacttcgtcacgctggtggtgttc
ggcctgatcttcgcgctgggtgtgctgggcaacagcctagtgatcaccgtgctggcgcgc
agcaagccgggcaagccgcggagcaccaccaacctgttcatcctcaacctgagcatcgcc
gacctggcctacctgctcttctgcatccccttccaggccaccgtgtacgcgctgcccacc
tgggtgctgggcgccttcatctgcaagttcatccactacttcttcaccgtgtccatgctg
gtgagcatcttcaccctggccgcgatgtccgtggaccgctacgtggccatcgtgcactcg
cggcgctcctcctccctcagggtgtcccgcaacgcgctgctgggcgtgggctgcatctgg
gcgctgtccattgccatggcctcgcccgtggcctaccaccagggcctcttccacccgcgc
gccagcaaccagaccttctgctgggagcagtggcccgaccctcgccacaagaaggcctac
gtggtgtgcaccttcgtcttcggctacctgctgccgctcctgctcatctgcttctgctat
gccaaggtccttaatcacttgcataaaaagttgaagaacatgtcaaagaagtctgaagca
tccaagaaaaagactgcacagacagttctggtggtggttgtggtgtttggaatctcctgg
ctgccgcaccacatcatccatctctgggctgagtttggagttttcccgctgacgccggct
tccttcctcttcagaatcaccgcccactgcctggcgtacagcaattcctccgtgaatcct
atcatttatgcatttctctctgaaaatttcaggaaggcctataaacaagtgttcaagtgt
cacattcgcaaagattcacacctgagtgatactaaagaaagtaaaagtcgaatagacacc
ccaccatcaaccaattgtactcatgtgtga

KEGG   Homo sapiens (human): 8484
Entry
8484              CDS       T01001                                 

Gene name
GALR3
Definition
(RefSeq) galanin receptor 3
  KO
K04232  galanin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8484 (GALR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8484 (GALR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Galanin
    8484 (GALR3)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 8484
NCBI-ProteinID: NP_003605
OMIM: 603692
HGNC: 4134
Ensembl: ENSG00000128310
Vega: OTTHUMG00000150658
Pharos: O60755(Tchem)
UniProt: O60755
LinkDB
Position
22q13.1
AA seq 368 aa
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggctgatgcccagaacatttcactggacagcccagggagtgtgggggccgtggcagtg
cctgtggtctttgccctaatcttcctgctgggcacagtgggcaatgggctggtgctggca
gtgctcctgcagcctggcccgagtgcctggcaggagcctggcagcaccacggacctgttc
atcctcaacctggcggtggctgacctctgcttcatcctgtgctgcgtgcccttccaggcc
accatctacacgctggatgcctggctctttggggccctcgtctgcaaggccgtgcacctg
ctcatctacctcaccatgtacgccagcagctttacgctggctgctgtctccgtggacagg
tacctggccgtgcggcacccgctgcgctcgcgcgccctgcgcacgccgcgtaacgcccgc
gccgcagtggggctggtgtggctgctggcggcgctcttctcggcgccctacctcagctac
tacggcaccgtgcgctacggcgcgctggagctctgcgtgcccgcctgggaggacgcgcgc
cgccgcgccctggacgtggccaccttcgctgccggctacctgctgcccgtggctgtggtg
agcctggcctacgggcgcacgctgcgcttcctgtgggccgccgtgggtcccgcgggcgcg
gcggcggccgaggcgcggcggagggcgacgggccgcgcggggcgcgccatgctggcggtg
gccgcgctctacgcgctctgctggggtccgcaccacgcgctcatcctgtgcttctggtac
ggccgcttcgccttcagcccggccacctacgcctgccgcctggcctcacactgcctggcc
tacgccaactcctgcctcaacccgctcgtctacgcgctcgcctcgcgccacttccgcgcg
cgcttccgccgcctgtggccgtgcggccgccgacgccgccaccgtgcccgccgcgccttg
cgtcgcgtccgccccgcgtcctcgggcccacccggctgccccggagacgcccggcctagc
gggaggctgctggctggtggcggccagggcccggagcccagggagggacccgtccacggc
ggagaggctgcccgaggaccggaataa

KEGG   Homo sapiens (human): 8811
Entry
8811              CDS       T01001                                 

Gene name
GALR2, GAL2-R, GALNR2, GALR-2
Definition
(RefSeq) galanin receptor 2
  KO
K04231  galanin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8811 (GALR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8811 (GALR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Galanin
    8811 (GALR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv Flavi_capsid
Other DBs
NCBI-GeneID: 8811
NCBI-ProteinID: NP_003848
OMIM: 603691
HGNC: 4133
Ensembl: ENSG00000182687
Vega: OTTHUMG00000167479
Pharos: O43603(Tchem)
UniProt: O43603
LinkDB
Position
17q25.1
AA seq 387 aa
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaacgtctcgggctgcccaggggccgggaacgcgagccaggcgggcggcgggggaggc
tggcaccccgaggcggtcatcgtgcccctgctcttcgcgctcatcttcctcgtgggcacc
gtgggcaacacgctggtgctggcggtgctgctgcgcggcggccaggcggtcagcactacc
aacctgttcatccttaacctgggcgtggccgacctgtgtttcatcctgtgctgcgtgccc
ttccaggccaccatctacaccctggacggctgggtgttcggctcgctgctgtgcaaggcg
gtgcacttcctcatcttcctcaccatgcacgccagcagcttcacgctggccgccgtctcc
ctggacaggtatctggccatccgctacccgctgcactcccgcgagctgcgcacgcctcga
aacgcgctggcagccatcgggctcatctgggggctgtcgctgctcttctccgggccctac
ctgagctactaccgccagtcgcagctggccaacctgaccgtgtgccatcccgcgtggagc
gcccctcgccgccgcgccatggacatctgcaccttcgtcttcagctacctgcttcctgtg
ctggttctcggcctgacctacgcgcgcaccttgcgctacctctggcgcgccgtcgacccg
gtggccgcgggctcgggtgcccggcgcgccaagcgcaaggtgacacgcatgatcctcatc
gtggccgcgctcttctgcctctgctggatgccccaccacgcgctcatcctctgcgtgtgg
ttcggccagttcccgctcacgcgcgccacttatgcgcttcgcatcctctcgcacctggtc
tcctacgccaactcctgcgtcaaccccatcgtttacgcgctggtctccaagcacttccgc
aaaggcttccgcacgatctgcgcgggcctgctgggccgtgccccaggccgagcctcgggc
cgtgtgtgcgctgccgcgcggggcacccacagtggcagcgtgttggagcgcgagtccagc
gacctgttgcacatgagcgaggcggcgggggcccttcgtccctgccccggcgcttcccag
ccatgcatcctcgagccctgtcctggcccgtcctggcagggcccaaaggcaggcgacagc
atcctgacggttgatgtggcctga

DBGET integrated database retrieval system