KEGG   Homo sapiens (human): 2700Help
Entry
2700              CDS       T01001                                 

Gene name
GJA3, CTRCT14, CX46, CZP3
Definition
(RefSeq) gap junction protein alpha 3
  KO
K07612  gap junction alpha-3 protein
Organism
hsa  Homo sapiens (human)
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2700 (GJA3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2700 (GJA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin Connexin40_C
Motif
Other DBs
NCBI-GeneID: 2700
NCBI-ProteinID: NP_068773
OMIM: 121015
HGNC: 4277
Ensembl: ENSG00000121743
Vega: OTTHUMG00000016510
Pharos: Q9Y6H8(Tbio)
UniProt: Q9Y6H8
LinkDB All DBs
Position
13q12.11
AA seq 435 aa AA seqDB search
MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPG
CENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESP
SPKEPPQDNPSSRDDRGRVRMAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFELKPLYR
CDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHLGWKKLKQGVTSRLGP
DASEAPLGTADPPPLPPSSRPPAVAIGFPPYYAHTAAPLGQARAVGYPGAPPPAADFKLL
ALTEARGKGQSAKLYNGHHHLLMTEQNWANQAAERQPPALKAYPAASTPAAPSPVGSSSP
PLAHEAEAGAAPLLLDGSGSSLEGSALAGTPEEEEQAVTTAAQMHQPPLPLGDPGRASKA
SRASSGRARPEDLAI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggagctttctgggaagactcttagaaaatgcacaggagcactccacggtc
atcggcaaggtttggctgaccgtgctgttcatcttccgcatcttggtgctgggggccgcg
gcggaggacgtgtggggcgatgagcagtcagacttcacctgcaacacccagcagccgggc
tgcgagaacgtctgctacgacagggccttccccatctcccacatccgcttctgggcgctg
cagatcatcttcgtgtccacgcccaccctcatctacctgggccacgtgctgcacatcgtg
cgcatggaagagaagaagaaagagagggaggaggaggagcagctgaagagagagagcccc
agccccaaggagccaccgcaggacaatccctcgtcgcgggacgaccgcggcagggtgcgc
atggccggggcgctgctgcggacctacgtcttcaacatcatcttcaagacgctgttcgag
gtgggcttcatcgccggccagtactttctgtacggcttcgagctgaagccgctctaccgc
tgcgaccgctggccctgccccaacacggtggactgcttcatctccaggcccacggagaag
accatcttcatcatcttcatgctggcggtggcctgcgcgtccctgctgctcaacatgctg
gagatctaccacctgggctggaagaagctcaagcagggcgtgaccagccgcctcggcccg
gacgcctccgaggccccgctggggacagccgatcccccgcccctgccccccagctcccgg
ccgcccgccgttgccatcgggttcccaccctactatgcgcacaccgctgcgcccctggga
caggcccgcgccgtgggctaccccggggccccgccaccagccgcggacttcaaactgcta
gccctgaccgaggcgcgcggaaagggccagtccgccaagctctacaacggccaccaccac
ctgctgatgactgagcagaactgggccaaccaggcggccgagcggcagcccccggcgctc
aaggcttacccggcagcgtccacgcctgcagcccccagccccgtcggcagcagctccccg
ccactcgcgcacgaggctgaggcgggcgcggcgcccctgctgctggatgggagcggcagc
agtctggaggggagcgccctggcagggacccccgaggaggaggagcaggccgtgaccacc
gcggcccagatgcaccagccgcccttgcccctcggagacccaggtcgggccagcaaggcc
agcagggccagcagcgggcgggccagaccggaggacttggccatctag

DBGET integrated database retrieval system