KEGG   Homo sapiens (human): 283629
Entry
283629            CDS       T01001                                 

Gene name
TSSK4, C14orf20, STK22E, TSK-4, TSK4, TSSK5
Definition
(RefSeq) testis specific serine kinase 4
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    283629 (TSSK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    283629 (TSSK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     283629 (TSSK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   283629 (TSSK4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    283629 (TSSK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH Haspin_kinase
Other DBs
NCBI-GeneID: 283629
NCBI-ProteinID: NP_777604
OMIM: 610711
HGNC: 19825
Ensembl: ENSG00000139908
Vega: OTTHUMG00000029323
Pharos: Q6SA08(Tbio)
UniProt: Q6SA08
LinkDB
Position
14q12
AA seq 328 aa
MGKGDVLEAAPTTTAYHSLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKK
ASDDYLNKFLPREIQVMKVLRHKYLINFYRAIESTSRVYIILELAQGGDVLEWIQRYGAC
SEPLAGKWFSQLTLGIAYLHSKSIVHRDLKLENLLLDKWENVKISDFGFAKMVPSNQPVG
CSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWSMGVILYTLVVAHLPFD
DTNLKKLLRETQKEVTFPANHTISQECKNLILQMLRQATKRATILDIIKDSWVLKFQPEQ
PTHEIRLLEAMCQLHNTTKQHQSLQITT
NT seq 987 nt   +upstreamnt  +downstreamnt
atggggaagggagatgtcttagaggcagcaccaaccaccacagcctaccattccctcatg
gatgaatatggttatgaggtgggcaaggccattggccatggctcctatgggtcggtatat
gaggctttctacacaaagcagaaggttatggtggcagtcaagatcatctcaaagaagaag
gcctctgatgactatcttaacaagttcctgccccgtgaaatacaggtaatgaaagtcttg
cggcacaagtacctcatcaacttctatcgggccattgagagcacatctcgagtatacatc
attctggaactggctcagggtggtgatgtccttgaatggatccagcgctacggggcctgc
tctgagccccttgctggcaagtggttctcccagctgaccctgggcattgcctacctgcac
agcaagagcatcgtgcaccgggacttaaagttggagaacctgttgctggacaagtgggag
aatgtgaagatatcagactttggctttgccaagatggtgccttctaaccagcctgtgggt
tgtagcccttcttaccgccaagtgaactgcttttcccacctcagccagacttactgtggc
agctttgcttacgcttgcccagagatcttacgaggcttgccctacaaccctttcctgtct
gacacctggagcatgggcgtcatcctttacactctagtggtcgcccatctgccctttgat
gacaccaatctcaaaaagctgctaagagagactcagaaggaggtcactttcccagctaac
cataccatctcccaggagtgcaagaacctgatcctccagatgctacgccaagccactaag
cgtgccaccattctggacatcatcaaggattcctgggtgctcaagttccagcctgagcaa
cccacccatgagatcaggctgcttgaggccatgtgccagctccacaacaccactaaacag
caccaatccttgcaaattacgacctga

DBGET integrated database retrieval system