KEGG   Homo sapiens (human): 2874
Entry
2874              CDS       T01001                                 

Gene name
GPS2, AMF-1
Definition
(RefSeq) G protein pathway suppressor 2
  KO
K15307  G protein pathway suppressor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2874 (GPS2)
SSDB
Motif
Pfam: G_path_suppress MAT1
Other DBs
NCBI-GeneID: 2874
NCBI-ProteinID: NP_004480
OMIM: 601935
HGNC: 4550
Ensembl: ENSG00000132522
Vega: OTTHUMG00000102198
Pharos: Q13227(Tbio)
UniProt: Q13227
LinkDB
Structure
PDB: 
2L5G

Position
17p13.1
AA seq 327 aa
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERM
SLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSL
TVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQF
QGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQ
TGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGK
SGFAATSQPGPRLPFIQHSQNPRFYHK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcccgcactcctggagcgccccaagctttccaacgccatggccagggcgctgcaccgg
cacattatgatggagcgggagcgcaagcggcaggaggaagaagaggtggataagatgatg
gaacagaagatgaaggaagaacaggagagaaggaagaaaaaggagatggaagagagaatg
tcattagaggagaccaaggaacaaattctgaagttggaggagaagcttttggctctacag
gaagagaagcaccagcttttcctgcagctcaagaaagttttacatgaggaagaaaaacgg
aggcgaaaggaacagagtgacctgaccaccctaacatcagctgcataccagcagagcctg
actgttcacacaggaactcatctcctcagcatgcaggggagccctggaggacacaatcgc
ccaggcaccctcatggcagctgacagagccaaacaaatgtttggaccccaagtgcttacg
acccggcactacgtgggctcagcagctgcttttgcagggacaccagagcatggacaattc
caaggcagtcctggtggtgcctatgggactgctcagcccccacctcactatgggcccaca
cagccagcttatagtcctagtcagcagctcagagctccttcggcattccctgcagtgcag
tacctatctcagccacagccacagccctatgctgtgcatggccactttcagcccactcag
acaggtttcctccagcctggtggtgccctgtccttgcaaaagcagatggaacatgctaac
cagcagactggcttctccgactcatcctctctgcgccccatgcacccccaggctctgcat
ccagcccctggactccttgcttccccccagctccctgtgcagatgcagccagcaggaaag
tcgggctttgcagctaccagccaacctggccctcggctccccttcatccaacacagccag
aacccgcgattctaccacaagtga

DBGET integrated database retrieval system