KEGG   Homo sapiens (human): 2956
Entry
2956              CDS       T01001                                 

Gene name
MSH6, GTBP, GTMBP, HNPCC5, HSAP, p160
Definition
(RefSeq) mutS homolog 6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03430  Mismatch repair
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Disease
H00020  Colorectal cancer
H00876  Mismatch repair deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    2956 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2956 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    2956 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2956 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2956 (MSH6)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     2956 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II UPF0524
Other DBs
NCBI-GeneID: 2956
NCBI-ProteinID: NP_000170
OMIM: 600678
HGNC: 7329
Ensembl: ENSG00000116062
Vega: OTTHUMG00000129129
Pharos: P52701(Tbio)
UniProt: P52701 Q3SWU9
LinkDB
Structure
PDB: 

Position
2p16.3
AA seq 1360 aa
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPL
ARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR
SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR
KRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSS
RPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN
FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV
ARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLL
SLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN
LSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVMLPQVLK
GMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTT
RSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCA
PLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS
RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEG
RFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRN
RIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLIN
AEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL
LPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEQENGKAYCVLVTGPNMGGK
STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI
LMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA
REFEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL
NT seq 4083 nt   +upstreamnt  +downstreamnt
atgtcgcgacagagcaccctgtacagcttcttccccaagtctccggcgctgagtgatgcc
aacaaggcctcggccagggcctcacgcgaaggcggccgtgccgccgctgcccccggggcc
tctccttccccaggcggggatgcggcctggagcgaggctgggcctgggcccaggcccttg
gcgcgctccgcgtcaccgcccaaggcgaagaacctcaacggagggctgcggagatcggta
gcgcctgctgcccccaccagttgtgacttctcaccaggagatttggtttgggccaagatg
gagggttacccctggtggccttgtctggtttacaaccacccctttgatggaacattcatc
cgcgagaaagggaaatcagtccgtgttcatgtacagttttttgatgacagcccaacaagg
ggctgggttagcaaaaggcttttaaagccatatacaggttcaaaatcaaaggaagcccag
aagggaggtcatttttacagtgcaaagcctgaaatactgagagcaatgcaacgtgcagat
gaagccttaaataaagacaagattaagaggcttgaattggcagtttgtgatgagccctca
gagccagaagaggaagaagagatggaggtaggcacaacttacgtaacagataagagtgaa
gaagataatgaaattgagagtgaagaggaagtacagcctaagacacaaggatctaggcga
agtagccgccaaataaaaaaacgaagggtcatatcagattctgagagtgacattggtggc
tctgatgtggaatttaagccagacactaaggaggaaggaagcagtgatgaaataagcagt
ggagtgggggatagtgagagtgaaggcctgaacagccctgtcaaagttgctcgaaagcgg
aagagaatggtgactggaaatggctctcttaaaaggaaaagctctaggaaggaaacgccc
tcagccaccaaacaagcaactagcatttcatcagaaaccaagaatactttgagagctttc
tctgcccctcaaaattctgaatcccaagcccacgttagtggaggtggtgatgacagtagt
cgccctactgtttggtatcatgaaactttagaatggcttaaggaggaaaagagaagagat
gagcacaggaggaggcctgatcaccccgattttgatgcatctacactctatgtgcctgag
gatttcctcaattcttgtactcctgggatgaggaagtggtggcagattaagtctcagaac
tttgatcttgtcatctgttacaaggtggggaaattttatgagctgtaccacatggatgct
cttattggagtcagtgaactggggctggtattcatgaaaggcaactgggcccattctggc
tttcctgaaattgcatttggccgttattcagattccctggtgcagaagggctataaagta
gcacgagtggaacagactgagactccagaaatgatggaggcacgatgtagaaagatggca
catatatccaagtatgatagagtggtgaggagggagatctgtaggatcattaccaagggt
acacagacttacagtgtgctggaaggtgatccctctgagaactacagtaagtatcttctt
agcctcaaagaaaaagaggaagattcttctggccatactcgtgcatatggtgtgtgcttt
gttgatacttcactgggaaagtttttcataggtcagttttcagatgatcgccattgttcg
agatttaggactctagtggcacactatcccccagtacaagttttatttgaaaaaggaaat
ctctcaaaggaaactaaaacaattctaaagagttcattgtcctgttctcttcaggaaggt
ctgatacccggctcccagttttgggatgcatccaaaactttgagaactctccttgaggaa
gaatattttagggaaaagctaagtgatggcattggggtgatgttaccccaggtgcttaaa
ggtatgacttcagagtctgattccattgggttgacaccaggagagaaaagtgaattggcc
ctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctt
ttatcaatggctaattttgaagaatatattcccttggattctgacacagtcagcactaca
agatctggtgctatcttcaccaaagcctatcaacgaatggtgctagatgcagtgacatta
aacaacttggagatttttctgaatggaacaaatggttctactgaaggaaccctactagag
agggttgatacttgccatactccttttggtaagcggctcctaaagcaatggctttgtgcc
ccactctgtaaccattatgctattaatgatcgtctagatgccatagaagacctcatggtt
gtgcctgacaaaatctccgaagttgtagagcttctaaagaagcttccagatcttgagagg
ctactcagtaaaattcataatgttgggtctcccctgaagagtcagaaccacccagacagc
agggctataatgtatgaagaaactacatacagcaagaagaagattattgattttctttct
gctctggaaggattcaaagtaatgtgtaaaattatagggatcatggaagaagttgctgat
ggttttaagtctaaaatccttaagcaggtcatctctctgcagacaaaaaatcctgaaggt
cgttttcctgatttgactgtagaattgaaccgatgggatacagcctttgaccatgaaaag
gctcgaaagactggacttattactcccaaagcaggctttgactctgattatgaccaagct
cttgctgacataagagaaaatgaacagagcctcctggaatacctagagaaacagcgcaac
agaattggctgtaggaccatagtctattgggggattggtaggaaccgttaccagctggaa
attcctgagaatttcaccactcgcaatttgccagaagaatacgagttgaaatctaccaag
aagggctgtaaacgatactggaccaaaactattgaaaagaagttggctaatctcataaat
gctgaagaacggagggatgtatcattgaaggactgcatgcggcgactgttctataacttt
gataaaaattacaaggactggcagtctgctgtagagtgtatcgcagtgttggatgtttta
ctgtgcctggctaactatagtcgagggggtgatggtcctatgtgtcgcccagtaattctg
ttgccggaagataccccccccttcttagagcttaaaggatcacgccatccttgcattacg
aagactttttttggagatgattttattcctaatgacattctaataggctgtgaggaagag
gagcaggaaaatggcaaagcctattgtgtgcttgttactggaccaaatatggggggcaag
tctacgcttatgagacaggctggcttattagctgtaatggcccagatgggttgttacgtc
cctgctgaagtgtgcaggctcacaccaattgatagagtgtttactagacttggtgcctca
gacagaataatgtcaggtgaaagtacattttttgttgaattaagtgaaactgccagcata
ctcatgcatgcaacagcacattctctggtgcttgtggatgaattaggaagaggtactgca
acatttgatgggacggcaatagcaaatgcagttgttaaagaacttgctgagactataaaa
tgtcgtacattattttcaactcactaccattcattagtagaagattattctcaaaatgtt
gctgtgcgcctaggacatatggcatgcatggtagaaaatgaatgtgaagaccccagccag
gagactattacgttcctctataaattcattaagggagcttgtcctaaaagctatggcttt
aatgcagcaaggcttgctaatctcccagaggaagttattcaaaagggacatagaaaagca
agagaatttgagaagatgaatcagtcactacgattatttcgggaagtttgcctggctagt
gaaaggtcaactgtagatgctgaagctgtccataaattgctgactttgattaaggaatta
tag

KEGG   Homo sapiens (human): 4437
Entry
4437              CDS       T01001                                 

Gene name
MSH3, DUP, FAP4, MRP1
Definition
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03430  Mismatch repair
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4437 (MSH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4437 (MSH3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    4437 (MSH3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4437 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4437 (MSH3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     4437 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV
Other DBs
NCBI-GeneID: 4437
NCBI-ProteinID: NP_002430
OMIM: 600887
HGNC: 7326
Ensembl: ENSG00000113318
Vega: OTTHUMG00000162540
Pharos: P20585(Tbio)
UniProt: P20585
LinkDB
Structure
PDB: 
3THX 3THY 3THW 3THZ

Position
5q14.1
AA seq 1137 aa
MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAA
AAPPAPPAPAFPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSE
PKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNA
VSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRSKSIYTPLELQYIEMK
QQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAK
GYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKLDDAVNVDEIM
TDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDT
VDIKGSQIISGIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGT
TLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEV
LHSESSVFGQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQAIIPAVN
SHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKTELFKDLSDFPLIKKRKDEIQ
GVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSRF
HSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMG
GKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTA
EIIRKATSQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKN
YSHQVGNYHMGFLVSEDESKLDPGAAEQVPDFVTFLYQITRGIAARSYGLNVAKLADVPG
EILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQKWTEEFNMEETQTSLLH
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgtctcgccggaagcctgcgtcgggcggcctcgctgcctccagctcagcccctgcgagg
caagcggttttgagccgattcttccagtctacgggaagcctgaaatccacctcctcctcc
acaggtgcagccgaccaggtggaccctggcgctgcagcggctgcagcggccgcagcggcc
gcagcgcccccagcgcccccagctcccgccttcccgccccagctgccgccgcacatagct
acagaaattgacagaagaaagaagagaccattggaaaatgatgggcctgttaaaaagaaa
gtaaagaaagtccaacaaaaggaaggaggaagtgatctgggaatgtctggcaactctgag
ccaaagaaatgtctgaggaccaggaatgtttcaaagtctctggaaaaattgaaagaattc
tgctgcgattctgcccttcctcaaagtagagtccagacagaatctctgcaggagagattt
gcagttctgccaaaatgtactgattttgatgatatcagtcttctacacgcaaagaatgca
gtttcttctgaagattcgaaacgtcaaattaatcaaaaggacacaacactttttgatctc
agtcagtttggatcatcaaatacaagtcatgaaaatttacagaaaactgcttccaaatca
gctaacaaacggtccaaaagcatctatacgccgctagaattacaatacatagaaatgaag
cagcagcacaaagatgcagttttgtgtgtggaatgtggatataagtatagattctttggg
gaagatgcagagattgcagcccgagagctcaatatttattgccatttagatcacaacttt
atgacagcaagtatacctactcacagactgtttgttcatgtacgccgcctggtggcaaaa
ggatataaggtgggagttgtgaagcaaactgaaactgcagcattaaaggccattggagac
aacagaagttcactcttttcccggaaattgactgccctttatacaaaatctacacttatt
ggagaagatgtgaatcccctaatcaagctggatgatgctgtaaatgttgatgagataatg
actgatacttctaccagctatcttctgtgcatctctgaaaataaggaaaatgttagggac
aaaaaaaagggcaacatttttattggcattgtgggagtgcagcctgccacaggcgaggtt
gtgtttgatagtttccaggactctgcttctcgttcagagctagaaacccggatgtcaagc
ctgcagccagtagagctgctgcttccttcggccttgtccgagcaaacagaggcgctcatc
cacagagccacatctgttagtgtgcaggatgacagaattcgagtcgaaaggatggataac
atttattttgaatacagccatgctttccaggcagttacagagttttatgcaaaagataca
gttgacatcaaaggttctcaaattatttctggcattgttaacttagagaagcctgtgatt
tgctctttggctgccatcataaaatacctcaaagaattcaacttggaaaagatgctctcc
aaacctgagaattttaaacagctatcaagtaaaatggaatttatgacaattaatggaaca
acattaaggaatctggaaatcctacagaatcagactgatatgaaaaccaaaggaagtttg
ctgtgggttttagaccacactaaaacttcatttgggagacggaagttaaagaagtgggtg
acccagccactccttaaattaagggaaataaatgcccggcttgatgctgtatcggaagtt
ctccattcagaatctagtgtgtttggtcagatagaaaatcatctacgtaaattgcccgac
atagagaggggactctgtagcatttatcacaaaaaatgttctacccaagagttcttcttg
attgtcaaaactttatatcacctaaagtcagaatttcaagcaataatacctgctgttaat
tcccacattcagtcagacttgctccggaccgttattttagaaattcctgaactcctcagt
ccagtggagcattacttaaagatactcaatgaacaagctgccaaagttggggataaaact
gaattatttaaagacctttctgacttccctttaataaaaaagaggaaggatgaaattcaa
ggtgttattgacgagatccgaatgcatttgcaagaaatacgaaaaatactaaaaaatcct
tctgcacaatatgtgacagtatcaggacaggagtttatgatagaaataaagaactctgct
gtatcttgtataccaactgattgggtaaaggttggaagcacaaaagctgtgagccgcttt
cactctccttttattgtagaaaattacagacatctgaatcagctccgggagcagctagtc
cttgactgcagtgctgaatggcttgattttctagagaaattcagtgaacattatcactcc
ttgtgtaaagcagtgcatcacctagcaactgttgactgcattttctccctggccaaggtc
gctaagcaaggagattactgcagaccaactgtacaagaagaaagaaaaattgtaataaaa
aatggaaggcaccctgtgattgatgtgttgctgggagaacaggatcaatatgtcccaaat
aatacagatttatcagaggactcagagagagtaatgataattaccggaccaaacatgggt
ggaaagagctcctacataaaacaagttgcattgattaccatcatggctcagattggctcc
tatgttcctgcagaagaagcgacaattgggattgtggatggcattttcacaaggatgggt
gctgcagacaatatatataaaggacagagtacatttatggaagaactgactgacacagca
gaaataatcagaaaagcaacatcacagtccttggttatcttggatgaactaggaagaggg
acgagcactcatgatggaattgccattgcctatgctacacttgagtatttcatcagagat
gtgaaatccttaaccctgtttgtcacccattatccgccagtttgtgaactagaaaaaaat
tactcacaccaggtggggaattaccacatgggattcttggtcagtgaggatgaaagcaaa
ctggatccaggcgcagcagaacaagtccctgattttgtcaccttcctttaccaaataact
agaggaattgcagcaaggagttatggattaaatgtggctaaactagcagatgttcctgga
gaaattttgaagaaagcagctcacaagtcaaaagagctggaaggattaataaatacgaaa
agaaagagactcaagtattttgcaaagttatggacgatgcataatgcacaagacctgcag
aagtggacagaggagttcaacatggaagaaacacagacttctcttcttcattaa

DBGET integrated database retrieval system