KEGG   Homo sapiens (human): 29904Help
Entry
29904             CDS       T01001                                 

Gene name
EEF2K, CaMKIII, HSU93850, eEF-2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    29904 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    29904 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    29904 (EEF2K)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     29904 (EEF2K)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   29904 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase Sel1
Motif
Other DBs
NCBI-GeneID: 29904
NCBI-ProteinID: NP_037434
OMIM: 606968
HGNC: 24615
Ensembl: ENSG00000103319
Vega: OTTHUMG00000094771
Pharos: O00418(Tbio)
UniProt: O00418
LinkDB All DBs
Structure
PDB: 

Position
16p12.2
AA seq 725 aa AA seqDB search
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggccagtccccccga
gctggccatgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcacggatgacccaagctcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatagctccagcgggtccccggcaaactccttccac
ttcaaggaagcctggaagcacgcaatccagaaggccaagcacatgcccgacccctgggct
gagttccacctggaagatattgccaccgaacgtgctactcgacacaggtacaacgccgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcttgcatgcccagcag
tggaagggcgcctccaactacgtggcgaagcgctacatcgagcccgtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataatcgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgaaggacaga
ccgggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaac
tccaactctggctttgtccgcgatgacaacatccgcctgacgccgcaggccttcagccac
ttcacttttgagcgttccggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacggagacgggcactgactttggagacggcaaccta
ggtgtccgcgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggatgcagtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagacgagaacatgagcgacgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgacctcgataac
atggcatccagagaccatgatcatctagacaaccaccgggagtctgagaatagtggggac
agcggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcatacagtaatcggaagtacgagtctgacgaagacagcctgggcagctctggacgg
gtatgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggcgaggagtgggaccaggagtcggctgtcttccacctggagcacgcagccaac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagttgcctcatcac
atcctagccgatgtctctctgaaggagacagaagagaacaaaaccaaaggatttgattac
ttactaaaggccgctgaagctggcgacaggcagtccatgatcctagtggcgcgagctttt
gactctggccagaacctcagcccggacaggtgccaagactggctagaggccctgcactgg
tacaacactgccctggagatgacggactgtgatgagggcggtgagtacgacggaatgcag
gacgagccccggtacatgatgctggccagggaggccgagatgctgttcacaggaggctac
gggctggagaaggacccgcagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccgactggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system