KEGG   Homo sapiens (human): 314
Entry
314               CDS       T01001                                 

Gene name
AOC2, DAO2, RAO, SSAO
Definition
(RefSeq) amine oxidase copper containing 2
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    314 (AOC2)
   00350 Tyrosine metabolism
    314 (AOC2)
   00360 Phenylalanine metabolism
    314 (AOC2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    314 (AOC2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     314 (AOC2)
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965 NPR1_interact
Other DBs
NCBI-GeneID: 314
NCBI-ProteinID: NP_033720
OMIM: 602268
HGNC: 549
Ensembl: ENSG00000131480
Vega: OTTHUMG00000180655
Pharos: O75106(Tchem)
UniProt: O75106
LinkDB
Position
17q21.31
AA seq 756 aa
MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLS
REELTAVMRFLTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREA
LAIVLFGGQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLK
EVELPKAPIFLSSTFNYNGSTLAAVHATPRGLRSGDRATWMALYHNISGVGLFLHPVGLE
LLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRN
SPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQGERIAYEVSVQ
ECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP
GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALE
GRVHATGYINTAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDV
VFKPVAAPWNPEHWLQRPQLTRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYR
IQIHSPLGIHIPLESDMERALSWGRYQLVVTQRKEEESQSSSIYHQNDIWTPTVTFADFI
NNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVY
FEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgcatctcaagatagtcctggcgttcctggcactgtccctcattaccatctttgccctg
gcctatgttttgctgaccagcccaggtggttccagccagcctccccactgcccctctgta
tcccatagggcccagccctggccacaccctggccagagccagctgtttgcagacctgagc
cgagaggagttgacagctgtgatgcgctttctgacccagcggctggggccagggctggtg
gacgcagcccaggctcagccctcggacaactgcatcttctcagtggagctgcagctgccc
cccaaggctgcagccctggcccacctggacagggggagccccccacctgcccgggaggca
ctggccatcgtcctctttggtggacaaccccaacccaatgtgagtgagctggtggtgggg
ccgctgcctcacccctcgtacatgcgggatgtgactgtggagcgtcacggcgggcccctg
ccctatcaccgtcgcccggtgctgagagctgagtttacacagatgtggaggcatctgaaa
gaggtggagctacccaaggcacccatcttcctgtcgtccaccttcaactacaatggctct
accctggcagctgtgcatgccacccctcggggcttgcgctcaggggaccgagctacctgg
atggccctctaccataacatctcaggggttggtcttttccttcaccccgtggggctggag
ctactactggaccacagggccctggaccctgcccactggactgtccagcaggtcttctac
cttgggcactactatgcagacttgggccagttggaacgggagtttaagtctggccggttg
gaagtggttagagtccctctacctccaccaaatggagcttcatccctgaggtctcggaac
tctccaggtcctcttccccctcttcagttctcgccccagggttcccagtacagtgtgcaa
ggaaacctggtggtatcctccctctggtcatttacctttggccatggggtgttcagcggc
ctgaggatttttgatgttcggttccagggtgagcgaatagcctatgaagtcagtgtccag
gagtgtgtatctatctatggtgccgattcacccaagacgatgctgactcgctatttggat
agcagctttggactcggccgtaacagccgaggcttggtgcggggagtggactgcccctat
caagccacgatggtggacatccatatattagtgggcaaaggggcagtccagctgcttcca
ggggctgtgtgtgtatttgaggaagcccagggactgccccttcgaaggcaccacaattac
cttcaaaatcatttctatggtggtttggccagctcagcccttgtggtcaggtctgtgtca
tctgtgggcaactatgactacatttgggactttgtgttgtacccaaatggggcacttgaa
gggcgggtccatgccacgggttatatcaacacagctttcctgaaagggggagaggagggc
ctcctctttgggaaccgtgtgggggaaagagtgctgggaacggtgcacacacatgccttc
cacttcaagctggacctggatgtggcagggctgaaaaactgggtggtagctgaagacgtg
gtgtttaaacctgtggctgccccctggaacccggagcactggctacagcgcccacagctg
actcggcaggtcctgggaaaggaggacctgacagctttttccttgggaagccccctaccc
cgctacctctacctggctagcaaccagactaatgcgtggggtcaccagcgcgggtaccga
atccagatccacagcccccttggcatacacatacccctggagagtgacatggagagggcc
ctcagctgggggagataccagcttgtggtgacccagagaaaggaggaggagtcacagagc
agtagcatctatcaccagaatgacatctggacacccacagttacctttgctgacttcatc
aacaatgaaaccctcttaggagaggatctggtggcttgggtcacagccagcttcctgcac
attccccatgccgaggacatcccaaacacagtgactctggggaacagagttggcttcttg
ctccgaccctataacttctttgatgaggacccctccatcttctcccctggcagtgtctac
tttgagaagggccaggatgctgggctctgcagcatcaatcctgtggcctgcctccccgac
ctggcagcctgtgtcccggacttaccccctttctcttaccacggcttctag

DBGET integrated database retrieval system