KEGG   Homo sapiens (human): 3242Help
Entry
3242              CDS       T01001                                 

Gene name
HPD, 4-HPPD, 4HPPD, GLOD3, HPPDASE, PPD
Definition
(RefSeq) 4-hydroxyphenylpyruvate dioxygenase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00044  Tyrosine degradation, tyrosine => homogentisate
Network
nt06016  Phenylalanine and tyrosine metabolism
  Element
N00708  Tyrosine degradation
N00709  FAH deficiency in tyrosine degradation
N00710  HPD deficiency in tyrosine degradation
N00712  HGD deficiency in tyrosine degradation
N10020  HPD inhibitior to downstream of deficinent FAH
Disease
H00165  Tyrosinemia
Drug target
Nitisinone: D05177
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    3242 (HPD)
   00360 Phenylalanine metabolism
    3242 (HPD)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    3242 (HPD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3242 (HPD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     3242 (HPD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3242 (HPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_5 RNase_Zc3h12a
Motif
Other DBs
NCBI-GeneID: 3242
NCBI-ProteinID: NP_002141
OMIM: 609695
HGNC: 5147
Ensembl: ENSG00000158104
Vega: OTTHUMG00000169081
Pharos: P32754(Tclin)
UniProt: P32754
LinkDB All DBs
Structure
PDB: 

Position
12q24.31
AA seq 393 aa AA seqDB search
MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQATSFYCSKMGFEPLAYRGLETGSREVVSH
VIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMRE
PWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEM
IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLR
EKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttacagtgacaaaggggcaaagcctgagagaggccgattcctccacttccac
tctgtgaccttctgggttggcaacgccaagcaggccacgtcattctactgcagcaagatg
ggctttgaacctctagcctacaggggcctggagaccggttcccgggaggtggtcagccat
gtaatcaaacaagggaagattgtgtttgtcctctcctcagcgctcaacccctggaacaaa
gagatgggcgatcacctggtgaaacacggtgacggagtgaaggacattgcgttcgaggtg
gaagattgtgactacatcgtgcagaaagcacgggaacggggcgccaaaatcatgcgggag
ccctgggtagagcaagacaagtttgggaaggtgaagtttgctgtgctgcagacgtatggg
gacaccacacacaccctggtggagaagatgaactacatcggccaattcttgcctggatat
gaggccccagcgttcatggaccccctacttcctaaactgcccaaatgcagtctggagatg
atcgaccacattgtgggaaaccagcctgatcaggagatggtgtccgcctccgaatggtac
ctgaaaaacctgcagttccaccgcttctggtccgtggatgacacgcaggtgcacacggaa
tatagctctctgcgatccattgtggtggccaactatgaagagtccatcaagatgcccatc
aatgagccagcgcctggcaagaagaagtcccagatccaggaatatgtggactataacggg
ggcgctggggtccagcacatcgctctcaagaccgaagacatcatcacagcgattcgccac
ttgagagagagaggcctggagttcttatctgttccctccacgtactacaaacaactgcgg
gagaagctgaagacggccaagatcaaggtgaaggagaacattgatgccctggaggagctg
aaaatcctggtggactacgacgagaaaggctacctcctgcagatcttcaccaaaccggtg
caggaccggcccacgctcttcctggaagtcatccagcgccacaaccaccagggttttgga
gccggcaacttcaactcactgttcaaggctttcgaggaggagcagaacctgcggggtaac
ctcaccaacatggagaccaatggggtggtgcccggcatgtaa

DBGET integrated database retrieval system