KEGG   Homo sapiens (human): 3346
Entry
3346              CDS       T01001                                 

Gene name
HTN1, HIS1
Definition
(RefSeq) histatin 1
  KO
K13913  histatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    3346 (HTN1)
SSDB
Motif
Pfam: Fungus-induced
Other DBs
NCBI-GeneID: 3346
NCBI-ProteinID: NP_002150
OMIM: 142701
HGNC: 5283
Ensembl: ENSG00000126550
Vega: OTTHUMG00000129397
Pharos: P15515(Tbio)
UniProt: P15515
LinkDB
Position
4q13.3
AA seq 57 aa
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
NT seq 174 nt   +upstreamnt  +downstreamnt
atgaagttttttgtctttgctttagtcttggctctcatgatttccatgattagcgctgat
tcacatgaaaagagacatcatgggtatagaagaaaattccatgaaaagcatcattcacat
cgagaatttccattttatggggactatggatcaaattatctatatgacaattga

KEGG   Homo sapiens (human): 3347
Entry
3347              CDS       T01001                                 

Gene name
HTN3, HIS2, HTN2, HTN5, PB
Definition
(RefSeq) histatin 3
  KO
K13913  histatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    3347 (HTN3)
SSDB
Motif
Pfam: AJAP1_PANP_C Antimicrobial10
Other DBs
NCBI-GeneID: 3347
NCBI-ProteinID: NP_000191
OMIM: 142702
HGNC: 5284
Ensembl: ENSG00000205649
Pharos: P15516(Tbio)
CPD: C15921
UniProt: P15516
LinkDB
Position
4q13.3
AA seq 51 aa
MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
NT seq 156 nt   +upstreamnt  +downstreamnt
atgaagttttttgtttttgctttaatcttggctctcatgctttccatgactggagctgat
tcacatgcaaagagacatcatgggtataaaagaaaattccatgaaaagcatcattcacat
cgaggctatagatcaaattatctgtatgacaattga

DBGET integrated database retrieval system