KEGG   Homo sapiens (human): 340061Help
Entry
340061            CDS       T01001                                 

Gene name
TMEM173, ERIS, MITA, MPYS, NET23, SAVI, STING, STING-beta, hMITA, hSTING
Definition
(RefSeq) transmembrane protein 173
  KO
K12654  transmembrane protein 173
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
Disease
H01746  STING-associated vasculopathy with onset in infancy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    340061 (TMEM173)
   04622 RIG-I-like receptor signaling pathway
    340061 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    340061 (TMEM173)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    340061 (TMEM173)
   05168 Herpes simplex virus 1 infection
    340061 (TMEM173)
   05163 Human cytomegalovirus infection
    340061 (TMEM173)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    340061 (TMEM173)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    340061 (TMEM173)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM173 Flavi_NS4B
Motif
Other DBs
NCBI-GeneID: 340061
NCBI-ProteinID: NP_938023
OMIM: 612374
HGNC: 27962
Ensembl: ENSG00000184584
Vega: OTTHUMG00000129239
Pharos: Q86WV6(Tbio)
UniProt: Q86WV6
LinkDB All DBs
Structure
PDB: 

Position
5q31.2
AA seq 379 aa AA seqDB search
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccccactccagcctgcatccatccatcccgtgtcccaggggtcacggggcccagaag
gcagccttggttctgctgagtgcctgcctggtgaccctttgggggctaggagagccacca
gagcacactctccggtacctggtgctccacctagcctccctgcagctgggactgctgtta
aacggggtctgcagcctggctgaggagctgcgccacatccactccaggtaccggggcagc
tactggaggactgtgcgggcctgcctgggctgccccctccgccgtggggccctgttgctg
ctgtccatctatttctactactccctcccaaatgcggtcggcccgcccttcacttggatg
cttgccctcctgggcctctcgcaggcactgaacatcctcctgggcctcaagggcctggcc
ccagctgagatctctgcagtgtgtgaaaaagggaatttcaacgtggcccatgggctggca
tggtcatattacatcggatatctgcggctgatcctgccagagctccaggcccggattcga
acttacaatcagcattacaacaacctgctacggggtgcagtgagccagcggctgtatatt
ctcctcccattggactgtggggtgcctgataacctgagtatggctgaccccaacattcgc
ttcctggataaactgccccagcagaccggtgaccatgctggcatcaaggatcgggtttac
agcaacagcatctatgagcttctggagaacgggcagcgggcgggcacctgtgtcctggag
tacgccacccccttgcagactttgtttgccatgtcacaatacagtcaagctggctttagc
cgggaggataggcttgagcaggccaaactcttctgccggacacttgaggacatcctggca
gatgcccctgagtctcagaacaactgccgcctcattgcctaccaggaacctgcagatgac
agcagcttctcgctgtcccaggaggttctccggcacctgcggcaggaggaaaaggaagag
gttactgtgggcagcttgaagacctcagcggtgcccagtacctccacgatgtcccaagag
cctgagctcctcatcagtggaatggaaaagcccctccctctccgcacggatttctcttga

DBGET integrated database retrieval system