KEGG   Homo sapiens (human): 358
Entry
358               CDS       T01001                                 

Gene name
AQP1, AQP-CHIP, CHIP28, CO
Definition
(RefSeq) aquaporin 1 (Colton blood group)
  KO
K09864  aquaporin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04924  Renin secretion
hsa04964  Proximal tubule bicarbonate reclamation
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    358 (AQP1)
  09154 Digestive system
   04976 Bile secretion
    358 (AQP1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    358 (AQP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    358 (AQP1)
   04147 Exosome [BR:hsa04147]
    358 (AQP1)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    358 (AQP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   358 (AQP1)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 358
NCBI-ProteinID: NP_932766
OMIM: 107776
HGNC: 633
Ensembl: ENSG00000240583
Vega: OTTHUMG00000023944
Pharos: P29972(Tbio)
UniProt: P29972 A0A024RA31
LinkDB
Structure
PDB: 
4CSK 1H6I 1IH5 1FQY 6POJ

Position
7p14.3
AA seq 269 aa
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLT
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
NT seq 810 nt   +upstreamnt  +downstreamnt
atggccagcgagttcaagaagaagctcttctggagggcagtggtggccgagttcctggcc
acgaccctctttgtcttcatcagcatcggttctgccctgggcttcaaatacccggtgggg
aacaaccagacggcggtccaggacaacgtgaaggtgtcgctggccttcgggctgagcatc
gccacgctggcgcagagtgtgggccacatcagcggcgcccacctcaacccggctgtcaca
ctggggctgctgctcagctgccagatcagcatcttccgtgccctcatgtacatcatcgcc
cagtgcgtgggggccatcgtcgccaccgccatcctctcaggcatcacctcctccctgact
gggaactcgcttggccgcaatgacctggctgatggtgtgaactcgggccagggcctgggc
atcgagatcatcgggaccctccagctggtgctatgcgtgctggctactaccgaccggagg
cgccgtgaccttggtggctcagccccccttgccatcggcctctctgtagcccttggacac
ctcctggctattgactacactggctgtgggattaaccctgctcggtcctttggctccgcg
gtgatcacacacaacttcagcaaccactggattttctgggtggggccattcatcggggga
gccctggctgtactcatctacgacttcatcctggccccacgcagcagtgacctcacagac
cgcgtgaaggtgtggaccagcggccaggtggaggagtatgacctggatgccgacgacatc
aactccagggtggagatgaagcccaaatag

DBGET integrated database retrieval system