KEGG   Homo sapiens (human): 373156
Entry
373156            CDS       T01001                                 

Gene name
GSTK1, GST, GST_13-13, GST13, GST13-13, GSTK1-1, hGSTK1
Definition
(RefSeq) glutathione S-transferase kappa 1
  KO
K13299  glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04146  Peroxisome
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    373156 (GSTK1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    373156 (GSTK1)
   00982 Drug metabolism - cytochrome P450
    373156 (GSTK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    373156 (GSTK1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    373156 (GSTK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     373156 (GSTK1)
SSDB
Motif
Pfam: DSBA Helicase_C_3 EAL
Other DBs
NCBI-GeneID: 373156
NCBI-ProteinID: NP_057001
OMIM: 602321
HGNC: 16906
Ensembl: ENSG00000197448
Vega: OTTHUMG00000152637
Pharos: Q9Y2Q3(Tchem)
UniProt: Q9Y2Q3 Q6FII1
LinkDB
Structure
PDB: 
3RPP 3RPN 1YZX

Position
7q34
AA seq 226 aa
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
NT seq 681 nt   +upstreamnt  +downstreamnt
atggggcccctgccgcgcaccgtggagctcttctatgacgtgctgtccccctactcctgg
ctgggcttcgagatcctgtgccggtatcagaatatctggaacatcaacctgcagttgcgg
cccagcctcataacagggatcatgaaagacagtggaaacaagcctccaggtctgcttccc
cgcaaaggactatacatggcaaatgacttaaagctcctgagacaccatctccagattccc
atccacttccccaaggatttcttgtctgtgatgcttgaaaaaggaagtttgtctgccatg
cgtttcctcaccgccgtgaacttggagcatccagagatgctggagaaagcgtcccgggag
ctgtggatgcgcgtctggtcaaggaatgaagacatcaccgagccgcagagcatcctggcg
gctgcagagaaggctggtatgtctgcagaacaagcccagggacttctggaaaagatcgca
acgccaaaggtgaagaaccagctcaaggagaccactgaggcagcctgcagatacggagcc
tttgggctgcccatcaccgtggcccatgtggatggccaaacccacatgttatttggctct
gaccggatggagctgctggcgcacctgctgggagagaagtggatgggccctatacctcca
gccgtgaatgccagactttaa

DBGET integrated database retrieval system