KEGG   Homo sapiens (human): 3776
Entry
3776              CDS       T01001                                 

Gene name
KCNK2, K2p2.1, TPKC1, TREK, TREK-1, TREK1, hTREK-1c, hTREK-1e
Definition
(RefSeq) potassium two pore domain channel subfamily K member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    3776 (KCNK2)
  09154 Digestive system
   04971 Gastric acid secretion
    3776 (KCNK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    3776 (KCNK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3776 (KCNK2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   3776 (KCNK2)
SSDB
Motif
Pfam: Ion_trans_2 bZIP_Maf
Other DBs
NCBI-GeneID: 3776
NCBI-ProteinID: NP_001017425
OMIM: 603219
HGNC: 6277
Ensembl: ENSG00000082482
Vega: OTTHUMG00000037017
Pharos: O95069(Tclin)
UniProt: O95069 Q6ZW95
LinkDB
Structure
PDB: 
4TWK

Position
1q41
AA seq 426 aa
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcttcccagcgcctcgcgggagagacccggctatagagcaggagtggcggcacctgac
ttgctggatcctaaatctgccgctcagaactccaaaccgaggctctcgttttccacgaaa
cccacagtgcttgcttcccgggtggagagtgacacgaccattaatgttatgaaatggaag
acggtctccacgatattcctggtggttgtcctctatctgatcatcggagccaccgtgttc
aaagcattggagcagcctcatgagatttcacagaggaccaccattgtgatccagaagcaa
acattcatatcccaacattcctgtgtcaattcgacggagctggatgaactcattcagcaa
atagtggcagcaataaatgcagggattataccgttaggaaacacctccaatcaaatcagt
cactgggatttgggaagttccttcttctttgctggcactgttattacaaccataggattt
ggaaacatctcaccacgcacagaaggcggcaaaatattctgtatcatctatgccttactg
ggaattcccctctttggttttctcttggctggagttggagatcagctaggcaccatattt
ggaaaaggaattgccaaagtggaagatacgtttattaagtggaatgttagtcagaccaag
attcgcatcatctcaacaatcatatttatactatttggctgtgtactctttgtggctctg
cctgcgatcatattcaaacacatagaaggctggagtgccctggacgccatttattttgtg
gttatcactctaacaactattggatttggtgactacgttgcaggtggatccgatattgaa
tatctggacttctataagcctgtcgtgtggttctggatccttgtagggcttgcttacttt
gctgctgtcctgagcatgattggagattggctccgagtgatatctaaaaagacaaaagaa
gaggtgggagagttcagagcacacgctgctgagtggacagccaacgtcacagccgaattc
aaagaaaccaggaggcgactgagtgtggagatttatgacaagttccagcgggccacctcc
atcaagcggaagctctcggcagaactggctggaaaccacaatcaggagctgactccttgt
aggaggaccctgtcagtgaaccacctgaccagcgagagggatgtcttgcctcccttactg
aagactgagagtatctatctgaatggtttgacgccacactgtgctggtgaagagattgct
gtgattgagaacatcaaatag

KEGG   Homo sapiens (human): 54207
Entry
54207             CDS       T01001                                 

Gene name
KCNK10, K2p10.1, PPP1R97, TREK-2, TREK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 10
  KO
K04920  potassium channel subfamily K member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    54207 (KCNK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    54207 (KCNK10)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    54207 (KCNK10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54207 (KCNK10)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   54207 (KCNK10)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans PDZ_3 DUF2390 PLC-beta_C E1-E2_ATPase
Other DBs
NCBI-GeneID: 54207
NCBI-ProteinID: NP_066984
OMIM: 605873
HGNC: 6273
Ensembl: ENSG00000100433
Vega: OTTHUMG00000170743
Pharos: P57789(Tclin)
UniProt: P57789
LinkDB
Structure
PDB: 
4BW5 4XDL 4XDK 4XDJ

Position
14q31.3
AA seq 538 aa
MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ
GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS
PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG
KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI
LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV
WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV
EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS
LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgttttttctctacacagacttctttctttccttggtggccgttcccgcagcagcaccg
gtgtgccagcccaagagcgccactaacgggcaacccccggctccggctccgactccaact
ccgcgcctgtccatttcctcccgagccacagtggtagccaggatggaaggcacctcccaa
gggggcttgcagaccgtcatgaagtggaagacggtggttgccatctttgtggttgtggtg
gtctaccttgtcactggcggtcttgtcttccgggcattggagcagccctttgagagcagc
cagaagaataccatcgccttggagaaggcggaattcctgcgggatcatgtctgtgtgagc
ccccaggagctggagacgttgatccagcatgctcttgatgctgacaatgcgggagtcagt
ccaataggaaactcttccaacaacagcagccactgggacctcggcagtgcctttttcttt
gctggaactgtcattacgaccatagggtatgggaatattgctccgagcactgaaggaggc
aaaatcttttgtattttatatgccatctttggaattccactctttggtttcttattggct
ggaattggagaccaacttggaaccatctttgggaaaagcattgcaagagtggagaaggtc
tttcgaaaaaagcaagtgagtcagaccaagatccgggtcatctcaaccatcctgttcatc
ttggccggctgcattgtgtttgtgacgatccctgctgtcatctttaagtacatcgagggc
tggacggccttggagtccatttactttgtggtggtcactctgaccacggtgggctttggt
gattttgtggcagggggaaacgctggcatcaattatcgggagtggtataagcccctagtg
tggttttggatccttgttggccttgcctactttgcagctgtcctcagtatgatcggagat
tggctacgggttctgtccaaaaagacaaaagaagaggtgggtgaaatcaaggcccatgcg
gcagagtggaaggccaatgtcacggctgagttccgggagacacggcgaaggctcagcgtg
gagatccacgataagctgcagcgggcggccaccatccgcagcatggagcgccggcggctg
ggcctggaccagcgggcccactcactggacatgctgtcccccgagaagcgctctgtcttt
gctgccctggacaccggccgcttcaaggcctcatcccaggagagcatcaacaaccggccc
aacaacctgcgcctgaaggggccggagcagctgaacaagcatgggcagggtgcgtccgag
gacaacatcatcaacaagttcgggtccacctccagactcaccaagaggaaaaacaaggac
ctcaaaaagaccttgcccgaggacgttcagaaaatctacaagaccttccggaattactcc
ctggacgaggagaagaaagaggaggagacggaaaagatgtgtaactcagacaactccagc
acagccatgctgacggactgtatccagcagcacgctgagttggagaacggaatgataccc
acggacaccaaagaccgggagccggagaacaactcattacttgaagacagaaactaa

DBGET integrated database retrieval system