KEGG   Homo sapiens (human): 3835Help
Entry
3835              CDS       T01001                                 

Gene name
KIF22, A-328A3.2, KID, KNSL4, OBP, OBP-1, OBP-2, SEMDJL2
Definition
(RefSeq) kinesin family member 22
  KO
K10403  kinesin family member 22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04914  Progesterone-mediated oocyte maturation
Disease
H01494  SEMD with joint laxity type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    3835 (KIF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3835 (KIF22)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3835 (KIF22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6 PsbU
Motif
Other DBs
NCBI-GeneID: 3835
NCBI-ProteinID: NP_015556
OMIM: 603213
HGNC: 6391
Ensembl: ENSG00000079616
Vega: OTTHUMG00000097771
Pharos: Q14807(Tbio)
UniProt: Q14807
LinkDB All DBs
Structure
PDB: 

Position
16p11.2
AA seq 665 aa AA seqDB search
MAAGGSTQQRRREMAAASAAAISGAGRCRLSKIGATRRPPPARVRVAVRLRPFVDGTAGA
SDPPCVRGMDSCSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQN
ASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIY
QEKVLDLLDPASGDLVIREDCRGNILIPGLSQKPISSFADFERHFLPASRNRTVGATRLN
QRSSRSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINTS
LFVLGKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYLDTVSALN
FAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARGPEEEEIGSPEPMAAPA
SASQKLSPLQKLSSMDPAMLERLLSLDRLLASQGSQGAPLLSTPKRERMVLMKTVEEKDL
EIERLKTKQKELEAKMLAQKAEEKENHCPTMLRPLSHRTVTGAKPLKKAVVMPLQLIQEQ
AASPNAEIHILKNKGRKRKLESLDALEPEEKAEDCWELQISPELLAHGRQKILDLLNEGS
ARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
RCGAS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggcggctcgacgcagcagaggcgacgcgagatggcggcagcttcagcggcg
gcgatctcaggagctggtcgctgtcggctaagcaagattggagctactcgtcgtccacct
ccagctcgcgtaagggtggctgtgcgactgcggccatttgtggatggaacagcgggagca
agtgatcccccctgtgtgcggggcatggacagctgctctctagagattgctaactggagg
aaccaccaggagactctcaaataccagtttgatgccttctatggggagaggagtactcag
caggacatctatgcaggttcagtgcagcccatcctaaggcacttgctggaagggcagaat
gccagtgtgcttgcctatggacccacaggagctgggaagacgcacacaatgctgggcagc
ccagagcaacctggggtgatcccgcgggctctcatggacctcctgcagctcacaagggag
gagggtgccgagggccggccatgggccctttctgtcaccatgtcttacctagagatctac
caggagaaggtattagacctcctggaccctgcttcgggagacctggtaatccgagaagac
tgccgggggaatatcctgattccgggtctctcccagaagcccatcagtagctttgctgat
tttgagcggcacttcctgccagccagtcgaaatcggactgtaggagccacccggctcaac
cagcgctcctcccgcagtcatgctgtgctcctggtcaaggtggaccagcgggaacgtttg
gccccatttcgccagcgagagggaaaactctacctgattgacttggctgggtcagaggac
aaccggcgcacaggcaacaagggccttcggctaaaagagagtggagccatcaacacctcc
ctgtttgtcctgggcaaagtggtagatgcgctgaatcagggcctccctcgtgtaccttat
cgggacagcaagctcactcgcctattgcaggactctctgggtggctcagcccacagtatc
cttattgccaacattgcccctgagagacgcttctacctagacacagtctccgcactcaac
tttgctgccaggtccaaggaggtgatcaatcggccttttaccaatgagagcctgcagcct
catgccttgggacctgttaagctgtctcagaaagaattgcttggtccaccagaggcaaag
agagcccgaggccctgaggaagaggagatcgggagccctgagcccatggcagctccagcc
tctgcctcccagaaactcagccccctacagaagctaagcagcatggacccggccatgctg
gagcgcctcctcagcttggaccgtctgcttgcctcccaggggagccagggggcccctctg
ttgagtaccccaaagcgagagcggatggtgctaatgaagacagtggaagagaaggaccta
gagattgagaggcttaagacgaagcaaaaagaactggaggccaagatgttggcccagaag
gctgaggaaaaggagaaccattgtcccacaatgctccggcccctttcacatcgcacagtc
acaggggcaaagcccctgaaaaaggctgtggtgatgcccctacagctaattcaggagcag
gcagcatccccaaatgccgagatccacatcctgaagaataaaggccggaagagaaagctg
gagtccctggatgccctagagcctgaggagaaggctgaggactgctgggagctacagatc
agcccggagctactggctcatgggcgccaaaaaatactggatctgctgaacgaaggctca
gcccgagatctccgcagtcttcagcgcattggcccgaagaaggcccagctaatcgtgggc
tggcgggagctccacggccccttcagccaggtggaggacctggaacgcgtggagggcata
acggggaaacagatggagtccttcctgaaggcaaacatcctgggtctcgccgccggccag
cgctgtggcgcctcctga

DBGET integrated database retrieval system