KEGG   Homo sapiens (human): 3993
Entry
3993              CDS       T01001                                 

Gene name
LLGL2, HGL, Hugl-2, LGL2
Definition
(RefSeq) LLGL scribble cell polarity complex component 2
  KO
K06094  lethal(2) giant larvae protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
nt06135  Cytoskeletal regulation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00340  The Scribble/Dlg/Lgl polarity module
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    3993 (LLGL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    3993 (LLGL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3993 (LLGL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3993 (LLGL2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    3993 (LLGL2)
SSDB
Motif
Pfam: LLGL WD40 Lgl_C
Other DBs
NCBI-GeneID: 3993
NCBI-ProteinID: NP_001026973
OMIM: 618483
HGNC: 6629
Ensembl: ENSG00000073350
Vega: OTTHUMG00000179685
Pharos: Q6P1M3(Tbio)
UniProt: Q6P1M3 A0PJJ0
LinkDB
Structure
PDB: 
6N8R 6N8Q 6N8P 6N8S

Position
17q25.1
AA seq 1020 aa
MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYG
APGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLR
GPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQR
DGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIF
QGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEE
LVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEW
PIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFS
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQ
AVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFAD
TYLKDSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGIL
VLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEG
SRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIAS
CVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARN
SGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgaggcggttcctgaggccagggcatgaccctgtgcgggagaggctcaagcgggacctg
ttccagtttaacaagacggtggagcatggcttcccgcaccagcccagcgccctcggctac
agcccgtccctgcgcatcctggccatcggcacccgttctggagccatcaagctctacgga
gccccaggcgtggagttcatggggctgcaccaggagaacaacgctgtgacgcagatccac
ctcctgcccggccagtgccagctggtcaccctgctggatgacaacagcctgcacctttgg
agcctgaaggtcaagggcggggcatcggagctgcaggaggatgagagcttcacactgcgt
ggacccccaggggctgcccccagtgccacacagatcaccgtggtcctgccacattcctcc
tgcgagctgctctacctgggcaccgagagtggcaacgtgtttgtggtgcagctgccagct
tttcgtgcgctggaggaccggaccatcagctcggacgcggtgctgcagcggttgccagag
gaggcccgccaccggcgtgtgttcgagatggtggaggcactgcaggagcaccctcgagac
cccaaccagatcctgatcggctacagccgaggcctcgttgtcatctgggacctacagggc
agccgcgtgctctaccacttcctcagcagccagcaactggagaacatctggtggcagcgg
gacggccgcctgctcgtcagctgtcactctgacggcagctactgccagtggcccgtgtcc
agcgaagcccagcaaccagagcccctccgcagcctcgtgccttacggtccctttccttgc
aaagcgattaccagaatcctctggctgaccactaggcaggggttgcccttcaccatcttc
cagggtggcatgccacgggccagctacggggaccgccactgcatctcagtgatccacgat
ggccagcagacggccttcgacttcacctcccgtgtcatcggcttcactgtcctcacagag
gcagaccctgcagccacctttgacgacccctatgccctggtggtgctggctgaggaggag
ctggtggtgattgacctgcagacagcaggctggccaccggtccagctgccctacctggct
tctctgcactgttccgccatcacctgctctcaccacgtctccaacatcccgctgaagctg
tgggagcggatcattgccgccggcagccggcagaacgcacacttctccaccatggagtgg
ccaattgatggtggcaccagcctgaccccagccccaccccagagggacctgctgctcaca
gggcacgaggacggcacggtgcggttctgggatgcctcgggtgtctgcctgcggctgctc
tacaaactcagcactgtgcgcgtgttcctcaccgacacggaccccaacgagaacttcagt
gcccagggcgaggacgagtggcccccactccgcaaggtgggctcctttgacccctacagt
gatgacccccggctgggcatccagaagatcttcctctgcaagtacagcggctacctggct
gtggcaggcacggcagggcaggtgctggtactggaactgaatgacgaggcagcggagcag
gctgtggagcaggtggaggccgacctgctgcaggaccaagagggctaccgctggaagggg
cacgagcgcctggcagcccgctcagggcccgtgcgctttgagcctggctttcagcccttc
gtgttggtgcagtgtcagcccccggctgtggtcacctccttggccctgcactctgagtgg
cggctcgtggccttcggcaccagccatggctttggcctctttgaccaccagcagcggcgg
caggtctttgttaagtgcacactgcaccccagtgaccagctggccttggagggcccactc
tcccgcgtcaagtccctcaagaagtccttgcgtcagtcattccgccggatgcgtcggagc
cgggtgtccagccggaagcggcacccggctggccccccaggagaggcacaggaggggagt
gccaaggctgagcggccaggcctccagaacatggagctggcgcctgtgcagcgcaagatc
gaggctcgctcggcagaggactccttcacaggcttcgtccggaccctgtactttgctgac
acctacctgaaggacagctcccggcactgcccctcgctgtgggctggcaccaatgggggc
accatctatgccttctccctgcgtgtgcctcccgccgagcggagaatggatgagcctgtg
cgggcagagcaggccaaggagatccagctgatgcaccgggcgccggtggtgggcatcctg
gtgctcgacggacacagcgtaccccttcccgagcccctcgaagtggcccatgatctgtcg
aagagccctgacatgcagggaagccaccagctgctcgtcgtatcagaggagcagttcaag
gtgttcacgctgcccaaggtgagtgccaagctgaagttgaagctgacggccctggagggc
tcaagagtgcggcgggtcagcgtggcccacttcggcagtcgtcgagccgaggactacggg
gagcaccacctggcagtccttaccaacctgggcgacatccaggtggtctcgctgcccctg
ctcaagccccaggtgcgctacagctgcatccgccgggaggacgtcagtggcatcgcctcc
tgcgtcttcaccaaatatggccaaggcttctacctgatctcaccctcggagtttgagcgc
ttctctctctccaccaagtggctggtggagccccggtgtctggtggattcagcagaaacc
aagaaccaccgccctggtaacggtgcgggccccaagaaggccccgagccgagccaggaac
tcagggactcagagtgatggcgaggagaagcagcccggcctggtgatggagcgcgctctg
ctcagtgatgagagagtcctgaaggaaatccagagcacactggagggagaccgcgggagc
ggcaactggcgttcacatcgagccgccgtggggtgcagcctcagcaatggcggagcagag
tga

KEGG   Homo sapiens (human): 3996
Entry
3996              CDS       T01001                                 

Gene name
LLGL1, DLG4, HUGL, HUGL-1, HUGL1, LLGL, Lgl1, Mgl1
Definition
(RefSeq) LLGL scribble cell polarity complex component 1
  KO
K06094  lethal(2) giant larvae protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
nt06135  Cytoskeletal regulation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00340  The Scribble/Dlg/Lgl polarity module
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    3996 (LLGL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    3996 (LLGL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3996 (LLGL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3996 (LLGL1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    3996 (LLGL1)
SSDB
Motif
Pfam: LLGL WD40 Lgl_C
Other DBs
NCBI-GeneID: 3996
NCBI-ProteinID: NP_004131
OMIM: 600966
HGNC: 6628
Ensembl: ENSG00000131899
Vega: OTTHUMG00000059396
Pharos: Q15334(Tbio)
UniProt: Q15334
LinkDB
Position
17p11.2
AA seq 1064 aa
MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKI
YGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQ
LPSRPGFDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGE
VLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVIWNQASQCVDHIFLGNQQL
ESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVATTPYGPFPCKAINKILWRNCE
SGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTRPEDEFDDPQA
LAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQS
PQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQ
TDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLV
LELSDVPVEQAVSVAIIDLLQDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAA
VTAVTLHTEWSLVAFGTSHGFGLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSL
RQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHDVEMTPVQRRIEPRSADDSLS
GVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRPEQAVEAVLGK
EVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPK
VSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVH
YSCIRKEDISGIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQA
SYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSAD
TTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDEAHACAILIK
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgatgaagtttcggttccggcggcagggcgccgacccgcagcgcgagaagctcaagcag
gagcttttcgccttcaacaagactgtggagcatggcttccccaatcagcccagcgccctg
gccttcgacccggaacttcgcatcatggccatcggcaccaggtctggggctgtcaagatc
tatggtgcacctggcgtggagttcacaggcctgcaccgggatgcagccactgtcacacag
atgcacttcttgaccggccagggccgcctcctgtccctgcttgatgacagcagtctgcat
ctctgggagattgtccaccataatggctgtgcccacctggaagaagcactcagtttccag
ctgcccagccggcccggctttgatggtgccagtgctccgctcagccttacccgagtcaca
gtggtcctgctggtggctgccagcgacatagcagccctgggcactgagggcagcagtgtc
ttcttcctggatgttaccaccctgaccctgctcgaggggcagacgcttgccccaggcgag
gttctgcgcagcgtgccagacgactaccgctgtgggaaggcactgggccccgtggagtca
ctccagggacacctgcgggaccccacaaagattctcattggctacagccggggcctgctg
gtcatctggaaccaggcctcgcagtgtgtggaccacatcttcctggggaaccagcagctg
gagagcctatgctgggggcgtgatagcagcactgtggtcagctcacacagcgatggcagc
tatgctgtctggtctgtggatgccggcagcttcccaacgctgcagcccacggtagccacc
acaccttacggcccctttccctgcaaggccattaacaagattctgtggcggaactgtgaa
tctgggggccactttatcatcttcagcggtggcatgccccgtgccagctatggtgaccgc
cactgtgtaagtgtgcttcgagccgagacattggtgacgctggacttcacttcccgcatc
atcgacttcttcacagtgcacagcacacggcccgaggatgaatttgatgacccccaggcc
ctggctgtgctgctggaagaggagctggtggtgctggacctgcagactcctggctggcca
gctgtgcctgccccatacctggccccgctgcactcctctgcaatcacttgctcggcccac
gtggccagtgtccccgccaagctgtgggcccgcattgtgagcgctggcgagcagcagagc
ccccagcctgtctccagtgccttgagctggcccatcactgggggccgaaacctggcccag
gagccgtcacagcgagggctgctgctgacgggccatgaggacggcaccgtgaggttctgg
gatgcctcgggtgtggcgctgcggccgctctataagctgagcacagctggcctcttccag
acagactgtgagcacgctgacagcctggcccaggctgccgaggacgactggccacccttc
cgcaaggtgggctgcttcgatccctacagtgacgatccccggcttggcgtgcagaaggtt
gctctctgcaagtatacagcccagatggtggtggctggcactgcaggccaggtgctggta
ctggagcttagtgatgtgccggtggagcaggcggtcagcgtggccatcatagacctcctc
caggaccgcgagggcttcacatggaagggccacgagcggctgagcccacgcacggggccg
ctgccctggcctgctggcttccagccccgtgtcctggtgcagtgcctgccgccagctgct
gtaaccgctgtcacactccacaccgagtggagcctcgtggcttttggcaccagtcatggc
tttggcctcttcgactaccagcgcaagagccctgtgctggccaggtgcactcttcacccc
aatgactccctggccatggagggtccgctctcccgggtgaagtctctcaagaagtcactg
cgccagtctttccggcgcattcgcaagagtcgtgtctctggcaagaagcgggctgctaat
gccagcagcaagttgcaggaagccaatgcacagctggctgagcaggcctgcccccacgac
gtggagatgacgcccgtgcagcgccgcattgagccccgctctgccgatgactccttgtcg
ggtgtcgtgcgttgcctatactttgccgacacattccttcgagatggggcccaccacggg
cccaccatgtgggctggcaccaactcaggctctgtgttcgcctatgcactggaggtgccg
gcagcagcagtgggtggtgagaagcggcctgagcaagcggtggaggccgtgctgggcaag
gaggtgcagctgatgcaccgggcgcctgtggtggccattgccgtgttggacgggcgtggc
cgcccactgcccgagccctacgaggcctcacgggacctggcgcaggcacctgacatgcag
ggtggtcacgctgtgctcatcgcatctgaggagcagttcaaggtgttcacactgcccaag
gtgagcgcgaagaccaagttcaagctgacggcccatgagggctgtcgtgtgcgcaaggtg
gcactggccacgtttgccagtgtggcctgcgaggactatgctgagacctgcctggcctgc
ctcaccaacctgggtgacgtccacgtcttctcggtgcctggcctgcggccccaggtgcac
tattcctgcatccggaaggaggacatcagcggcatcgcttcgtgcgtctttacgcgccat
ggccagggcttttacctgatatccccatcagaatttgaacgcttctccctaagtgcccgg
aacatcacagagccgctctgctctctggacattaactggccccgcgatgccacccaggcc
agttacaggatccgagagtcacccaagctgagccaggctaacgggaccccaagcatcctg
ctggccccacagagccttgatggaagccctgatccagcccacagcatgggacctgacacc
ccggagccacccgaggctgcactctcacccatgtccatcgactcagccaccagtgctgac
accacgctggacacgacaggggacgtcacagtggaagatgtgaaggatttcctgggctcc
tctgaggagtcagagaagaacctgaggaacctggcagaagacgaggcccacgcctgtgcc
atcctgatcaaatga

DBGET integrated database retrieval system