KEGG   Homo sapiens (human): 405753
Entry
405753            CDS       T01001                                 

Gene name
DUOXA2, SIMNIPHOM, TDH5
Definition
(RefSeq) dual oxidase maturation factor 2
  KO
K17232  dual oxidase maturation factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
Network
nt06322  TRH-TSH-TH signaling
  Element
N00795  DUOX2-generated H2O2 production
N00796  Mutation-inactivated DUOXA2 to DUOX2-generated H2O2 production
Disease
H00251  Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    405753 (DUOXA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    405753 (DUOXA2)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    405753 (DUOXA2)
SSDB
Motif
Pfam: DuoxA TMEM40
Other DBs
NCBI-GeneID: 405753
NCBI-ProteinID: NP_997464
OMIM: 612772
HGNC: 32698
Ensembl: ENSG00000140274
Vega: OTTHUMG00000131354
Pharos: Q1HG44(Tbio)
UniProt: Q1HG44
LinkDB
Position
15q21.1
AA seq 320 aa
MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLS
LFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARVRLLVGLEGINITLTGTPVHQL
NETIDYNEQFTWRLKENYAAEYANALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYA
SATLWVAFCFWLLSNVLLSTPAPLYGGLALLTTGAFALFGVFALASISSVPLCPLRLGSS
ALTTQYGAAFWVTLATGVLCLFLGGAVVSLQYVRPSALRTLLDQSAKDCSQERGGSPLIL
GDPLHKQAALPDLKCITTNL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaccctgtggaacggcgtactgcctttttacccccagccccggcatgccgcaggcttc
agcgttccactgctcatcgttattctagtgtttttggctctagcagcaagcttcctgctc
atcttgccggggatccgtggccactcgcgctggttttggttggtgagagttcttctcagt
ctgttcataggcgcagaaattgtggctgtgcacttcagtgcagaatggttcgtgggtaca
gtgaacaccaacacatcctacaaagccttcagcgcagcgcgcgttacagcccgtgtccgt
ctgctcgtgggcctggagggcattaatattacactcacagggaccccagtgcatcagctg
aacgagaccattgactacaacgagcagttcacctggcgtctgaaagagaattacgccgcg
gagtacgcgaacgcactggagaaggggctgccggacccagtgctctacctggcggagaag
ttcacaccgagtagcccttgcggcctgtaccaccagtaccacctggcgggacactacgcc
tcggccacgctatgggtggcgttctgcttctggctcctctccaacgtgctgctctccacg
ccggccccgctctacggaggcctggcactgctgaccaccggagccttcgcgctcttcggg
gtcttcgccttggcctccatctctagcgtgccgctctgcccgctccgcctaggctcctcc
gcgctcaccactcagtacggcgccgccttctgggtcacgctggcaaccggcgtcctgtgc
ctcttcctcggaggggccgtggtgagtctccagtatgttcggcccagcgctcttcgcacc
cttctggaccaaagcgccaaggactgcagccaggagagagggggctcacctcttatcctc
ggcgacccactgcacaagcaggccgctctcccagacttaaaatgtatcaccactaacctg
tga

DBGET integrated database retrieval system