KEGG   Homo sapiens (human): 50807
Entry
50807             CDS       T01001                                 

Gene name
ASAP1, AMAP1, CENTB4, DDEF1, PAG2, PAP, ZG14P
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    50807 (ASAP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    50807 (ASAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50807 (ASAP1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    50807 (ASAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    50807 (ASAP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   50807 (ASAP1)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_1 SH3_9 BAR Ank SH3_2 Ank_4 Ank_3 Ank_5 PH_3
Other DBs
NCBI-GeneID: 50807
NCBI-ProteinID: NP_060952
OMIM: 605953
HGNC: 2720
Ensembl: ENSG00000153317
Vega: OTTHUMG00000164772
Pharos: Q9ULH1(Tbio)
UniProt: Q9ULH1
LinkDB
Structure
PDB: 
2RQT 2RQU 2ED1 2DA0

Position
8q24.21-q24.22
AA seq 1129 aa
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgagatcttcagcctccaggctctccagtttttcgtcgagagattcactatggaatcgg
atgccggaccagatctctgtctcggagttcatcgccgagaccaccgaggactacaactcg
cccaccacgtccagcttcaccacgcggctgcacaactgcaggaacaccgtcacgctgctg
gaggaggctctagaccaagatagaacagcccttcagaaagtgaagaagtctgtaaaagca
atatataattctggtcaagatcatgtacaaaatgaagaaaactatgcacaagttcttgat
aagtttgggagtaattttttaagtcgagacaaccccgaccttggcaccgcgtttgtcaag
ttttctactcttacaaaggaactgtccacactgctgaaaaatctgctccagggtttgagc
cacaatgtgatcttcaccttggattctttgttaaaaggagacctaaagggagtcaaagga
gatctcaagaagccatttgacaaagcctggaaagattatgagacaaagtttacaaaaatt
gagaaagagaaaagagagcacgcaaaacaacatgggatgatccgcacagagataacagga
gctgagattgcggaagaaatggagaaggaaaggcgcctctttcagctccaaatgtgtgaa
tatctcattaaagttaatgaaatcaagaccaaaaagggtgtggatctgctgcagaatctt
ataaagtattaccatgcacagtgcaatttctttcaagatggcttgaaaacagctgataag
ttgaaacagtacattgaaaaactggctgctgatttatataatataaaacagacccaggat
gaagaaaagaaacagctaactgcactccgagacttaataaaatcctctcttcaactggat
cagaaagaagattctcagagccggcaaggaggatacagcatgcatcagctccagggcaat
aaggaatatggcagtgaaaagaaggggtacctgctaaagaaaagtgacgggatccggaaa
gtatggcagaggaggaagtgttcagtcaagaatgggattctgaccatctcacatgccaca
tctaacaggcaaccagccaagttgaaccttctcacctgccaagtaaaacctaatgccgaa
gacaaaaaatcttttgacctgatatcacataatagaacatatcactttcaggcagaagat
gagcaggattatgtagcatggatatcagtattgacaaatagcaaagaagaggccctaacc
atggccttccgtggagagcagagtgcgggagagaacagcctggaagacctgacaaaagcc
attattgaggatgtccagcggctcccagggaatgacatttgctgcgattgtggctcatca
gaacccacctggctttcaaccaacttgggtattttgacctgtatagaatgttctggcatc
catagggaaatgggggttcatatttctcgcattcagtctttggaactagacaaattagga
acttctgaactcttgctggccaagaatgtaggaaacaatagttttaatgatattatggaa
gcaaatttacccagcccctcaccaaaacccaccccttcaagtgatatgactgtacgaaaa
gaatatatcactgcaaagtatgtagatcataggttttcaaggaagacctgttcaacttca
tcagctaaactaaatgaattgcttgaggccatcaaatccagggatttacttgcactaatt
caagtctatgcagaaggggtagagctaatggaaccactgctggaacctgggcaggagctt
ggggagacagcccttcaccttgccgtccgaactgcagatcagacatctctccatttggtt
gacttccttgtacaaaactgtgggaacctggataagcagacggccctgggaaacacagtt
ctacactactgtagtatgtacagtaaacctgagtgtttgaagcttttgctcaggagcaag
cccactgtggatatagttaaccaggctggagaaactgccctagacatagcaaagagacta
aaagctacccagtgtgaagatctgctttcccaggctaaatctggaaagttcaatccacac
gtccacgtagaatatgagtggaatcttcgacaggaggagatagatgagagcgatgatgat
ctggatgacaaaccaagccctatcaagaaagagcgctcacccagacctcagagcttctgc
cactcctccagcatctccccccaggacaagctggcactgccaggattcagcactccaagg
gacaaacagcggctctcctatggagccttcaccaaccagatcttcgtttccacaagcaca
gactcgcccacatcaccaaccacggaggctccccctctgcctcctaggaacgccgggaaa
ggtccaactggcccaccttcaacactccctctaagcacccagacctctagtggcagctcc
accctatccaagaagaggcctcctcccccaccacccggacacaagagaaccctatccgac
cctcccagcccactacctcatgggcccccaaacaaaggcgcagttccttggggtaacgat
gggggtccatcctcttcaagtaagactacaaacaagtttgagggactatcccagcagtcg
agcaccagttctgcaaagactgcccttggcccaagagttcttcctaaactacctcagaaa
gtggcactaaggaaaacagatcatctctccctagacaaagccaccatcccgcccgaaatc
tttcagaaatcatcacagttggcagagttgccacaaaagccaccacctggagacctgccc
ccaaagcccacagaactggcccccaagccccaaattggagatttgccgcctaagccagga
gaactgccccccaaaccacagctgggggacctgccacccaaaccccaactctcagactta
cctcccaaaccacagatgaaggacctgccccccaaaccacagctgggagacctgctagca
aaatcccagactggagatgtctcacccaaggctcagcaaccctctgaggtcacactgaag
tcacacccattggatctatccccaaatgtgcagtccagagacgccatccaaaagcaagca
tctgaagactccaacgacctcacgcctactctgccagagacgcccgtaccactgcccaga
aaaatcaatacggggaaaaataaagtgaggcgagtgaagaccatttatgactgccaggca
gacaacgatgacgagctcacattcatcgagggagaagtgattatcgtcacaggggaagag
gaccaggagtggtggattggccacatcgaaggacagcctgaaaggaagggggtctttcca
gtgtcctttgttcatatcctgtctgactag

KEGG   Homo sapiens (human): 55616
Entry
55616             CDS       T01001                                 

Gene name
ASAP3, ACAP4, CENTB6, DDEFL1, UPLC1
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55616 (ASAP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    55616 (ASAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55616 (ASAP3)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    55616 (ASAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    55616 (ASAP3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   55616 (ASAP3)
SSDB
Motif
Pfam: ArfGap BAR_3 PH Ank_2 Ank_5 Ank_4 Ank Ank_3 DUF3287 PH_2 PH_3 PH_13
Other DBs
NCBI-GeneID: 55616
NCBI-ProteinID: NP_060177
OMIM: 616594
HGNC: 14987
Ensembl: ENSG00000088280
Vega: OTTHUMG00000003234
Pharos: Q8TDY4(Tbio)
UniProt: Q8TDY4 A0A024RAB1
LinkDB
Structure
PDB: 
2B0O

Position
1p36.12
AA seq 903 aa
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQ
DMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF
ARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
IARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAH
WASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVS
SLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
LQD
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgccggagcagttcagcgtcgccgagttcctggccgtcaccgcggaggacctcagctcc
ccggctggggccgccgccttcgccgccaagatgccccggtaccgaggggcggcgctggcg
cgggaggagatcttggaaggagaccaagccatcctgcagagaataaagaaggctgtgcgg
gcaatccatagctccggccttggccatgtggagaatgaagagcagtaccgagaggccgtg
gaatccttaggcaacagccacctgtcccagaacagccatgagctgtccacaggcttccta
aacttggccgtgttcacccgcgaggttgctgcgctcttcaagaacctgattcagaacttg
aacaacattgtctctttccccctggacagtctgatgaaggggcagctgagggacggtcga
caggattccaaaaaacagctggagaaggcatggaaggactatgaagccaaaatggccaag
ctggagaaggagcgcgatcgggccagggtgacaggagggatccctggggaggtggcccag
gacatgcagagagagcggcgcatcttccagctgcacatgtgtgagtatctgctcaaagcc
ggggagagccagatgaagcaaggtcctgacttccttcagagcctcatcaagttcttccac
gcccagcacaactttttccaagatggctggaaggctgcccagagcctgttccccttcatc
gagaagctggcggcctcagtacatgcactccatcaggcccaggaggacgagctacagaag
ctgacccagctccgggactccctccgagggacactgcagcttgagagcagagaggaacac
ctgagccggaagaactcaggatgtggctatagcatccaccagcaccaaggcaacaagcag
tttgggacggagaaagtgggctttctatacaagaaaagtgacggaattcgaagagtctgg
cagaaaaggaagtgtggagtcaagtatggctgcctgaccatctcacacagcacgataaac
cggcccccggtgaagctgaccctgctgacgtgccaagtgaggccaaaccctgaggagaaa
aagtgcttcgacctggtgacccacaaccggacgtaccactttcaggcagaggacgagcac
gagtgtgaggcgtgggtgtcagtgttgcagaacagcaaggacgaagccctgagcagcgcc
ttcctcggggagcccagcgctggcccggggtcctgggggtccgccggccatgatggggag
ccgcacgacctcacaaagctgctcatcgcggaggtgaagagcaggcctgggaatagccag
tgctgcgactgcggggctgcagaccccacgtggctcagcaccaacctgggcgtgctcacc
tgcatccagtgctcgggcgtccaccgcgaactgggcgtgcgcttttcgcgcatgcagtca
ctcaccttggacctgctgggcccctccgagttgttgctggccttgaacatgggaaacacg
agcttcaatgaggtcatggaggcccagctaccctcacacggcggccctaaaccctcagct
gagagtgacatgggcacccgcagggactacattatggccaagtatgtggagcataggttt
gcacgccggtgcacacctgagcctcagcgactctggacagccatttgcaacagggacctc
ctgtcggtactggaggcctttgccaatgggcaggactttggacagccgctgccagggcct
gatgcacaggcacctgaagaactcgtcttgcatttggctgtcaaagtcgccaaccaggct
tccctgcctctggtggatttcatcatccagaacggtggtcacctggatgccaaggctgct
gacgggaacacggctctgcactacgcagcactctacaaccagcccgactgcctcaagctg
ctgctgaaggggagagctttggttggcacagtaaatgaagcaggcgagacagctctggac
atagccaggaagaagcaccacaaggagtgtgaggagctgctggagcaggcccaggcgggg
acctttgccttccctctacatgtggactactcctgggtaatttccacagagcctggctct
gacagtgaggaggatgaggaagagaagcgctgcttgctgaagctcccggcccaggctcac
tgggccagtgggaggctggacatcagcaacaagacctatgagactgtcgccagcctggga
gcagccacccctcagggcgagagtgaggactgtcccccgcccttgccagtcaaaaactct
tctcggactttggtccaagggtgtgcaagacatgccagtggagatcgttctgaagtctcc
agcctgagttcagaggcccctgagacccctgagagcctgggcagtccagcctcctcctcc
agtctgatgagccccttggaacctggggatcccagccaagccccacccaactctgaagag
ggcctccgagagcccccaggcacctccagacccagcctgacatccgggaccaccccttcg
gagatgtacctccccgtcagattcagctccgagagcactcgctcctatcggcggggggcg
cggagccctgaagatggtccctcagccaggcagcctctgcccagaaggaacgtgccggtt
ggcatcactgaaggagatggctcaaggactgggagtctcccagcaagttctgtgcaactt
ttgcaagactag

KEGG   Homo sapiens (human): 8853
Entry
8853              CDS       T01001                                 

Gene name
ASAP2, AMAP2, CENTB3, DDEF2, PAG3, PAP, Pap-alpha, SHAG1
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8853 (ASAP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8853 (ASAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8853 (ASAP2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    8853 (ASAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    8853 (ASAP2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   8853 (ASAP2)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 SH3_1 Ank SH3_2 Ank_5 Ank_4 BAR Ank_3 PH_9 PH_13
Other DBs
NCBI-GeneID: 8853
NCBI-ProteinID: NP_003878
OMIM: 603817
HGNC: 2721
Ensembl: ENSG00000151693
Vega: OTTHUMG00000117485
Pharos: O43150(Tbio)
UniProt: O43150
LinkDB
Position
2p25.1; 2p24
AA seq 1006 aa
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
NT seq 3021 nt   +upstreamnt  +downstreamnt
atgccggaccagatctccgtgtcggaattcgtggccgagacccatgaggactacaaggcg
cccacggcctccagcttcaccacccgcacggcgcagtgccggaacactgtggcggccatc
gaggaggctttggacgtggaccggatggttctttacaaaatgaagaaatccgtgaaagca
atcaacagctctgggctggctcacgtggaaaatgaagagcagtacacccaggctctggag
aagtttggcggcaactgtgtatgcagagatgacccagatttaggaagtgcgttcctgaag
ttctcagtgtttacaaaggagttgacagcacttttcaaaaacctgattcagaatatgaac
aacataatctccttccctttggacagtttgctgaagggggacctgaaaggagtgaaaggg
gatctgaaaaagccttttgataaagcttggaaggactatgaaacaaaaataaccaagata
gaaaaggagaaaaaggaacacgccaagctccatgggatgattcggactgaaataagcgga
gcggaaattgccgaagagatggaaaaggagaggcgcttcttccagctacagatgtgcgag
tatctgctgaaggtcaacgaaatcaagattaaaaagggagtagatttacttcagaatctg
atcaaatactttcatgcccaatgcaatttttttcaggatggactcaaagccgtggaaagc
ctcaaaccttccattgaaacgctgtctacggatcttcacacgatcaaacaggcccaggat
gaagaaagaaggcagttgatacagcttcgagatattttgaaatccgcattgcaggttgaa
cagaaagaggactcccaaattcgtcagagcacagcttatagcttacatcagcctcaggga
aacaaggaacatgggaccgagcggaacggcagcctctacaagaagagtgacgggatccga
aaagtgtggcagaaaaggaaatgttcagttaaaaatggttttctgaccatatcccatggt
accgctaaccggcctcctgcaaagctcaacctgctaacctgccaggtgaagaccaaccct
gaggagaagaagtgctttgacctcatttcacatgacagaacttaccactttcaagctgaa
gatgaacaggaatgtcaaatatggatgtctgtgctgcaaaatagcaaagaagaagcttta
aacaatgcatttaagggggatgacaatactggagaaaataacatcgtccaagaactgaca
aaggagatcatctcagaagtgcagaggatgacgggcaatgacgtctgctgtgactgtggg
gcgccagatcctacatggctttccaccaacctgggcatcctgacctgcatcgagtgttcc
ggaatccaccgagagctgggggttcattattccaggatgcagtccctgaccttagatgta
ctgggaacatctgagctgctgctcgccaagaatattgggaatgcaggctttaatgagatc
atggaatgttgcctaccagctgaggactcagtcaaacccaacccaggcagcgacatgaat
gcaagaaaggactacatcacagccaagtacatcgagaggagatacgcaaggaagaagcac
gcggataacgcggcgaagcttcacagtctttgcgaggccgtcaaaacgagagatattttt
ggattgctccaagcttatgctgatggtgtggatcttacggaaaaaatcccactggccaac
ggacatgagccggatgaaacggccctccaccttgcagtcagatccgtggatcgaacctct
cttcacattgtagactttttagttcagaacagtgggaacctggataaacagacagggaaa
ggcagcacagccctgcactactgctgcctgaccgacaatgccgagtgcctcaagttgctc
ctgcgggggaaggcctccatcgagatagcaaacgagtcaggagagactccgctggacatt
gccaagcgcctcaagcacgagcactgtgaggagctgctgacccaagccttatctggaaga
tttaattctcacgttcacgttgaatatgaatggcgactactccacgaagacctggatgaa
agtgatgacgacatggatgagaaattgcagcccagtcccaaccggcgggaagaccggccc
atcagcttctaccagctgggctccaaccagcttcagtctaacgctgtatctttggccaga
gatgctgcaaaccttgccaaggagaagcagagggctttcatgcccagcatcttgcagaat
gagacttacggagccctcctgagtggcagcccacctcccgcccagcctgcagcccccagc
accaccagcgcccccccgcttcctccacggaatgttggcaaagttcagacagcctcctct
gctaacaccctgtggaagacaaactctgtaagtgtggacggtggaagccggcagcgatct
tcgtcagatccgccagctgtccatccaccgctgccccctcttcgcgtgacatctaccaat
cccctgacccccacgccgcccccacccgttgccaagacgcccagcgtaatggaagccttg
agccagccgagcaagcctgccccgcctgggatctcacagatcaggcccccacctctgccc
ccacagccgcccagccgcctcccgcagaagaagcctgcgccgggggctgacaagtccacc
ccactgaccaacaaaggccaaccgagaggacctgtggatctctctgcaacggaagctctg
ggtcctctgtccaatgctatggtcctgcagccccctgcacccatgcctaggaagtcgcag
gcaaccaagttgaagcctaagcgggtgaaagcgctctataactgtgtggctgacaacccc
gatgagctcaccttctccgagggggatgtgatcatcgtggacggggaggaggaccaggag
tggtggattggccacattgatggagatcctggtcgcaaaggcgcattcccggtgtcattt
gtgcactttatcgctgactga

DBGET integrated database retrieval system