KEGG   Homo sapiens (human): 50945
Entry
50945             CDS       T01001                                 

Gene name
TBX22, ABERS, CLPA, CPX, TBXX, dJ795G23.1
Definition
(RefSeq) T-box transcription factor 22
  KO
K10186  T-box protein 22
Organism
hsa  Homo sapiens (human)
Disease
H00909  Cleft palate with ankyloglossia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    50945 (TBX22)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   T-box
    50945 (TBX22)
SSDB
Motif
Pfam: T-box Glyco_hydro_36C
Other DBs
NCBI-GeneID: 50945
NCBI-ProteinID: NP_001103348
OMIM: 300307
HGNC: 11600
Ensembl: ENSG00000122145
Vega: OTTHUMG00000021901
Pharos: Q9Y458(Tbio)
UniProt: Q9Y458 B3KUL8
LinkDB
Position
Xq21.1
AA seq 520 aa
MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSSAAGKSEPLEK
QPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRR
MFPSVRVKVKGLDPGKQYHVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHP
DSPCSGETWMRQIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQS
LPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPW
RPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCP
EAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTN
SKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFS
MPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggctctgagctctcgggcgcgtgccttctccgtggaagccttggtggggagacccagc
aaaagaaaactccaagacccaatacaggcggagcagcctgagctgcgggagaaaaagggc
ggagaggaagaggaggagagaaggagcagcgctgcagggaagagcgagccgcttgaaaaa
caacctaagacagagccctcaacatctgcttcctctggctgcggcagcgacagcggctac
ggcaacagctctgaaagtctggaagagaaagatattcaaatggagcttcaaggatctgaa
ctgtggaaaagattccatgacatcgggactgagatgatcattactaaagcgggcaggcgg
atgttcccctctgttcgggtcaaggtgaaagggttggatccagggaagcagtaccatgtg
gccatcgatgtggtgccggtggattccaaacgctataggtacgtctatcacagctcacag
tggatggtagctgggaatacagaccatttgtgcatcattcctagattctatgttcacccg
gactcaccctgctcgggagagacctggatgcggcagatcatcagctttgatcgcatgaaa
ctcaccaacaatgagatggatgacaaaggccacatcattctgcaatccatgcataagtac
aaaccccgagtgcacgtgatagagcaaggcagcagtgttgacctgtcccagattcagtcc
ttgcccactgaaggtgttaaaacattctcctttaaagaaactgagttcaccacagtaacg
gcttaccaaaaccaacagattacgaaactaaaaatagaaagaaatccttttgctaaagga
tttagagatactggaagaaacaggggtgtattggatgggcttttagagacctacccatgg
aggccttctttcactctcgattttaaaacctttggcgcagacacacaaagtggaagcagt
ggctcatctccagtgacctctagtggaggggccccctctcctttgaactccttactttct
ccactttgcttttcacctatgtttcatttacctacaagctcccttggaatgccctgtcca
gaggcatacctgcccaatgtcaacctgcctctatgctacaagatttgtccaactaatttt
tggcaacagcaacctcttgttttaccggctcctgaaagactagcaagcagcaacagttct
cagtctttagccccactcatgatggaagtgcctatgttatcttccctgggggtcaccaat
tcaaaaagcggttcatctgaagactccagtgatcagtatctacaagcacctaattctacc
aatcaaatgttatatggattacagtcacctggaaatatttttctgccaaactccatcacc
ccagaagcacttagttgctcctttcatccttcctatgacttttatagatacaatttctct
atgccatctagactgataagtggttccaaccatcttaaagtgaatgacgacagtcaagtt
tcttttggagaaggcaaatgtaatcatgttcattggtatccagcaattaaccattacctt
tag

DBGET integrated database retrieval system