KEGG   Homo sapiens (human): 51268
Entry
51268             CDS       T01001                                 

Gene name
PIPOX, LPIPOX
Definition
(RefSeq) pipecolic acid and sarcosine oxidase
  KO
K00306  sarcosine oxidase / L-pipecolate oxidase [EC:1.5.3.1 1.5.3.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    51268 (PIPOX)
   00310 Lysine degradation
    51268 (PIPOX)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    51268 (PIPOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     51268 (PIPOX)
    1.5.3.7  L-pipecolate oxidase
     51268 (PIPOX)
SSDB
Motif
Pfam: DAO NAD_binding_8 HI0933_like Pyr_redox_2 GIDA FAD_binding_2 ApbA Thi4
Other DBs
NCBI-GeneID: 51268
NCBI-ProteinID: NP_057602
OMIM: 616713
HGNC: 17804
Ensembl: ENSG00000179761
Vega: OTTHUMG00000132679
Pharos: Q9P0Z9(Tbio)
UniProt: Q9P0Z9
LinkDB
Position
17q11.2
AA seq 390 aa
MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCL
SSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINP
GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVS
QAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcggctcagaaagatctctgggacgccattgtgattggggcggggatccagggctgc
ttcactgcataccacctggccaaacacaggaagaggatcctcctgctggagcagttcttt
ctaccacactcccgaggaagctcccatggacaaagccggataatccgaaaggcgtacctg
gaagacttttacacccggatgatgcatgagtgctatcagatatgggcccagctggagcac
gaggctggaacccaattgcacaggcagactggattactgctgctgggaatgaaagagaat
caagaattaaagacaatccaggccaatctgtcgaggcagagggtagaacaccagtgtctt
tcatctgaggaactgaagcaacgtttcccaaatattcggttgcccaggggagaagtgggg
ctcttggacaattccggaggagttatctatgcatataaggccctcagagccctgcaggat
gcaattcgacagctaggaggcatagtgcgtgacggagagaaggtggtggagataaaccca
gggctactggtcacggtgaaaaccacctccaggagctaccaagctaagagcttggtcatc
acagcaggtccttggaccaaccagctcctccgtcccctgggcattgagatgcctctccag
accctgcggatcaacgtgtgttactggcgagagatggttcctgggagctatggtgtgtcc
caggcctttccgtgcttcctgtggctgggcttgtgtccccaccacatctacggactgccc
acaggagagtacccagggctgatgaaggtcagctatcaccacggcaaccacgcagaccct
gaggagcgggactgccccacagcacgcacagacatcggagacgtccagatcctgagcagc
tttgtcagagatcacttacctgatctgaagcccgagcctgctgtcattgagagctgcatg
tacacgaatacccctgatgagcagttcattctcgatcgccacccaaagtatgacaacatt
gtcattggtgctggattctctgggcacgggttcaagctggcccctgtggtggggaagatc
ctgtatgaattaagcatgaaattaacaccatcttatgacttggcaccttttcgaatcagc
cgtttcccaagcctgggcaaagcccacctttga

DBGET integrated database retrieval system