KEGG   Homo sapiens (human): 5191
Entry
5191              CDS       T01001                                 

Gene name
PEX7, PBD9B, PTS2R, RCDP1, RD
Definition
(RefSeq) peroxisomal biogenesis factor 7
  KO
K13341  peroxin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00075  Refsum disease
H00205  Peroxisome biogenesis disorder
H00207  Rhizomelic chondrodysplasia punctata
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5191 (PEX7)
SSDB
Motif
Pfam: WD40 eIF2A
Other DBs
NCBI-GeneID: 5191
NCBI-ProteinID: NP_000279
OMIM: 601757
HGNC: 8860
Ensembl: ENSG00000112357
Vega: OTTHUMG00000015650
Pharos: O00628(Tbio)
UniProt: O00628 Q6FGN1
LinkDB
Position
6q23.3
AA seq 323 aa
MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRL
FRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQEVYSVDWS
QTRGEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTL
RIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLG
HTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPT
QVADCSWDETIKIYDPACLTIPA
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtgcggtgtgcggtggagcggcgcggatgctgcggacgccgggacgccacggctac
gccgccgagttctccccgtacctgccgggccgcctggcctgcgccaccgcgcagcactac
ggcatcgcgggctgtggaaccctactaatattggatccagatgaagctgggctaaggctt
tttagaagctttgactggaatgatggtttgtttgatgtgacttggagtgagaacaacgaa
catgtcctcatcacctgtagtggcgatggctcgctgcagctctgggacactgccaaagct
gcagggccactgcaagtctataaagaacacgctcaggaggtgtatagtgttgattggagc
caaaccagaggtgaacagcttgtggtgtctggctcatgggatcaaactgtcaaattgtgg
gatccaactgttggaaagtctctgtgcacctttagaggccatgaaagtattatttatagc
acaatctggtctccccacatccctggttgttttgcttcagcctcaggtgatcagactctg
agaatatgggatgtgaaggcagcaggagtaagaatcgtgattcctgcacatcaggcagaa
atcttgagttgtgactggtgtaaatacaatgagaatttgctggtgaccggggcggttgac
tgtagtttgagaggctgggacttaaggaatgtacgacaaccagtgtttgaacttcttggt
catacctatgctattaggagggtgaaattttcaccatttcatgcttctgtgctggcctct
tgctcgtatgattttactgtaagattctggaacttttcaaagcctgactctcttcttgaa
acagtggagcatcatacagagtttacttgtggtttagacttcagtcttcagagccccact
caggtggctgactgttcttgggatgaaacaataaagatctatgaccctgcttgtcttact
attcctgcttga

DBGET integrated database retrieval system