KEGG   Homo sapiens (human): 5211Help
Entry
5211              CDS       T01001                                 

Gene name
PFKL, ATP-PFK, PFK-B, PFK-L
Definition
(RefSeq) phosphofructokinase, liver type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
hsa04152  AMPK signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
N00739  ALDOA deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5211 (PFKL)
   00030 Pentose phosphate pathway
    5211 (PFKL)
   00051 Fructose and mannose metabolism
    5211 (PFKL)
   00052 Galactose metabolism
    5211 (PFKL)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    5211 (PFKL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5211 (PFKL)
   04152 AMPK signaling pathway
    5211 (PFKL)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5211 (PFKL)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5211 (PFKL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5211 (PFKL)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5211 (PFKL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5211 (PFKL)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5211 (PFKL)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     5211 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 5211
NCBI-ProteinID: NP_002617
OMIM: 171860
HGNC: 8876
Ensembl: ENSG00000141959
Vega: OTTHUMG00000086910
Pharos: P17858(Tbio)
UniProt: P17858 Q7L2M7
LinkDB All DBs
Position
21q22.3
AA seq 780 aa AA seqDB search
MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
AMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
VENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggtggacctggagaagctgcgggcgtcgggcgcgggcaaggccatcggcgtc
ctgaccagcggcggcgacgcgcaaggcatgaacgctgctgtccgggctgtgacgcgcatg
ggcatttatgtgggtgccaaagtcttcctcatctacgagggctatgagggcctcgtggag
ggaggtgagaacatcaagcaggccaactggctgagcgtctccaacatcatccagctgggc
ggcactatcattggcagcgctcgctgcaaggcctttaccaccagggaggggcgccgggca
gcggcctacaacctggtccagcacggcatcaccaacctgtgcgtcatcggcggggatggc
agcctcacaggtgccaacatcttccgcagcgagtggggcagcctgctggaggagctggtg
gcggaaggtaagatctcagagactacagcccggacctactcgcacctgaacatcgcgggc
ctagtgggctccatcgataacgacttctgcggcaccgacatgaccatcggcacggactcg
gccctccaccgcatcatggaggtcatcgatgccatcaccaccactgcccagagccaccag
aggaccttcgtgctggaagtgatgggccggcactgcgggtacctggcgctggtatctgca
ctggcctcaggggccgactggctgttcatccccgaggctccacccgaggacggctgggag
aacttcatgtgtgagaggctgggtgagactcggagccgtgggtcccgactgaacatcatc
atcatcgctgagggtgccattgaccgcaacgggaagcccatctcgtccagctacgtgaag
gacctggtggttcagaggctgggcttcgacacccgtgtaactgtgctgggccacgtgcag
cggggagggacgccctctgccttcgaccggatcctgagcagcaagatgggcatggaggcg
gtgatggcgctgctggaagccacgcctgacacgccggcctgcgtggtcaccctctcgggg
aaccagtcagtgcggctgcccctcatggagtgcgtgcagatgaccaaggaagtgcagaaa
gccatggatgacaagaggtttgacgaggccacccagctccgtggtgggagcttcgagaac
aactggaacatttacaagctcctcgcccaccagaagccccccaaggagaagtctaacttc
tccctggccatcctgaatgtgggggccccggcggctggcatgaatgcggccgtgcgctcg
gcggtgcggaccggcatctcccatggacacacagtatacgtggtgcacgatggcttcgaa
ggcctagccaagggtcaggtgcaagaagtaggctggcacgacgtggccggctggttgggg
cgtggtggctccatgctggggaccaagaggaccctgcccaagggccagctggagtccatt
gtggagaacatccgcatctatggtattcacgccctgctggtggtcggtgggtttgaggcc
tatgaaggggtgctgcagctggtggaggctcgcgggcgctacgaggagctctgcatcgtc
atgtgtgtcatcccagccaccatcagcaacaacgtccctggcaccgacttcagcctgggc
tccgacactgctgtaaatgccgccatggagagctgtgaccgcatcaaacagtctgcctcg
gggaccaagcgccgtgtgttcatcgtggagaccatggggggttactgtggctacctggcc
accgtgactggcattgctgtgggggccgacgccgcctacgtcttcgaggaccctttcaac
atccacgacttaaaggtcaacgtggagcacatgacggagaagatgaagacagacattcag
aggggcctggtgctgcggaacgagaagtgccatgactactacaccacggagttcctgtac
aacctgtactcatcagagggcaagggcgtcttcgactgcaggaccaatgtcctgggccac
ctgcagcagggtggcgctccaaccccctttgaccggaactatgggaccaagctgggggtg
aaggccatgctgtggttgtcggagaagctgcgcgaggtttaccgcaagggacgggtgttc
gccaatgccccagactcggcctgcgtgatcggcctgaagaagaaggcggtggccttcagc
cccgtcactgagctcaagaaagacactgatttcgagcaccgcatgccacgggagcagtgg
tggctgagcctgcggctcatgctgaagatgctggcacaataccgcatcagtatggccgcc
tacgtgtcaggggagctggagcacgtgacccgccgcaccctgagcatggacaagggcttc
tga

DBGET integrated database retrieval system