KEGG   Homo sapiens (human): 5213Help
Entry
5213              CDS       T01001                                 

Gene name
PFKM, ATP-PFK, GSD7, PFK-1, PFK-A, PFK1, PFKA, PFKX, PPP1R122
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04152  AMPK signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01945  Glycogen storage disease type VII
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5213 (PFKM)
   00030 Pentose phosphate pathway
    5213 (PFKM)
   00051 Fructose and mannose metabolism
    5213 (PFKM)
   00052 Galactose metabolism
    5213 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    5213 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5213 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    5213 (PFKM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5213 (PFKM)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5213 (PFKM)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     5213 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 5213
NCBI-ProteinID: NP_000280
OMIM: 610681
HGNC: 8877
Ensembl: ENSG00000152556
Vega: OTTHUMG00000169898
Pharos: P08237(Tbio)
UniProt: P08237 A0A024R0Y5
LinkDB All DBs
Structure
PDB: 

Position
12q13.11
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccattgctgtc
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatcttcaccggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagatcacatcaaggaagccacctgggagagcgtttcgatgatgcttcagctggga
ggcacggtgattggaagtgcccggtgcaaggactttcgggaacgagaaggacgactccga
gctgcctacaacctggtgaagcgtgggatcaccaatctctgtgtcattgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttgttgagtgacctccag
aaagcaggtaagatcacagatgaggaggctacgaagtccagctacctgaacattgtgggc
ctggttgggtcaattgacaatgacttctgtggcaccgatatgaccattggcactgactct
gccctgcatcggatcatggaaattgtagatgccatcactaccactgcccagagccaccag
aggacatttgtgttagaagtaatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgaatgtccaccagatgacgactgggag
gaacacctttgtcgccgactcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcaattgacaagaatggaaaaccaatcacctcagaagacatcaag
aatctggtggttaagcgtctgggatatgacacccgggttactgtcttggggcatgtgcag
aggggtgggacgccatcagcctttgacagaattctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagataccccagcctgtgtagtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggaatgtgtccaggtgaccaaagatgtgaccaag
gccatggatgagaagaaatttgacgaagccctgaagctgagaggccggagcttcatgaac
aactgggaggtgtacaagcttctagctcatgtcagacccccggtatctaagagtggttcg
cacacagtggctgtgatgaacgtgggggctccggctgcaggcatgaatgctgctgttcgc
tccactgtgaggattggccttatccagggcaaccgagtgctcgttgtccatgatggtttc
gagggcctggccaaggggcagatagaggaagctggctggagctatgttgggggctggact
ggccaaggtggctctaaacttgggactaaaaggactctacccaagaagagctttgaacag
atcagtgccaatataactaagtttaacattcagggccttgtcatcattgggggctttgag
gcttacacagggggcctggaactgatggagggcaggaagcagtttgatgagctctgcatc
ccatttgtggtcattcctgctacagtctccaacaatgtccctggctcagacttcagcgtt
ggggctgacacagcactcaatactatctgcacaacctgtgaccgcatcaagcagtcagca
gctggcaccaagcgtcgggtgtttatcattgagactatgggtggctactgtggctacctg
gctaccatggctggactggcagctggggccgatgctgcctacatttttgaggagcccttc
accattcgagacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgaaaagtgcaatgagaactataccactgacttcatt
ttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggt
cacatgcagcagggtgggagcccaaccccatttgataggaattttgccactaagatgggc
gccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaatactccagattcgggctgtgttctggggatgcgtaagagggctctggtcttc
caaccagtggctgagctgaaggaccagacagattttgagcatcgaatccccaaggaacag
tggtggctgaaactgaggcccatcctcaaaatcctagccaagtacgagattgacttggac
acttcagaccatgcccacctggagcacatcacccggaagcggtccggggaagctgccgtc
taa

DBGET integrated database retrieval system