KEGG   Homo sapiens (human): 55072
Entry
55072             CDS       T01001                                 

Gene name
RNF31, HOIP, Paul, ZIBRA
Definition
(RefSeq) ring finger protein 31
  KO
K11974  E3 ubiquitin-protein ligase RNF31 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N00945  Shigella IpaH1.4/2.5 to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55072 (RNF31)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    55072 (RNF31)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55072 (RNF31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55072 (RNF31)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     55072 (RNF31)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    55072 (RNF31)
  Multi subunit Ring-finger type E3
   LUBAC complex
    55072 (RNF31)
SSDB
Motif
Pfam: HOIP-UBA PUB_1 E3_UbLigase_RBR PUB IBR zf-RanBP
Other DBs
NCBI-GeneID: 55072
NCBI-ProteinID: NP_060469
OMIM: 612487
HGNC: 16031
Ensembl: ENSG00000092098
Vega: OTTHUMG00000028798
Pharos: Q96EP0(Tbio)
UniProt: Q96EP0
LinkDB
Structure
PDB: 

Position
14q12
AA seq 1072 aa
MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
HLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQR
QDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgccgggggaggaagaggagcgggccttcctggtggcccgcgaggagctggcgagcgcc
ctgaggagggattccgggcaggcgttttccctggagcagctccggccgctactagccagc
tctctgccgctagccgcccgctacctgcagctggacgccgcacgccttgtccgctgcaac
gctcatggggagccccgaaactacctcaacaccctgtccacggctctgaacatcctggag
aaatacggccgcaaccttctcagccctcagcggcctcggtactggcgtggtgtcaagttt
aataaccctgtctttcgcagcacggtggatgctgtgcaggggggccgagatgtgctgcga
ttatatggctacacagaggagcaaccagatgggttgagcttccccgaagggcaggaggag
ccagatgagcaccaggttgctacagtcacactggaagtactgctgcttcggacagagctc
agcctgctattgcagaatactcatccaagacagcaggcactggagcagctgttggaagac
aaggttgaagatgatatgctgcagctttcagaatttgaccccctattgagagagattgct
cctggccccctcaccacaccctctgtcccaggctccactcctggtccctgcttcctctgt
ggttctgccccaggcacactgcactgcccatcctgtaaacaggccctgtgtccagcctgt
gaccacctgttccatggacacccatcccgtgctcatcacctccgccagaccctgcctggg
gtcctgcagggtacccacctgagccccagtttacctgcctcagcccaaccacggccccag
tcgacctccctgctggccctgggagacagctctctttcttcccctaatcctgcaagtgct
catttgccctggcactgtgctgcctgtgccatgctaaatgagccttgggcagtgctctgt
gtggcctgtgatcggccccgaggctgtaaggggttggggttgggaactgagggtccccaa
ggaactggaggcctagaacctgatcttgcacggggtcggtgggcctgccagagctgtacc
tttgagaatgaggcagctgctgtgctatgttccatatgtgagcgacctcggctggcccag
cctcccagcttggtggtggattcccgagatgctggcatttgcctgcaaccccttcagcag
ggggatgctttgctggcctctgcccagagtcaagtctggtactgtattcactgtaccttc
tgcaactcgagccctggctgggtgtgtgttatgtgcaaccggactagtagccccattcca
gcacaacatgccccccggccctatgccagctctttggaaaagggaccccccaagcctggg
cccccacgacgccttagtgcccccctgcccagttcctgtggagatcctgagaagcagcgc
caagacaagatgcgggaagaaggcctccagctagtgagcatgatccgggaaggggaagcc
gcaggtgcctgtccagaggagatcttctcggctctgcagtactcgggcactgaggtgcct
ctgcagtggttgcgctcagaactgccctacgtcctggagatggtggctgagctggctgga
cagcaggaccctgggctgggtgccttttcctgtcaggaggcccggagagcctggctggat
cgtcatggcaaccttgatgaagctgtggaggagtgtgtgaggaccaggcgaaggaaggtg
caggagctccagtctctaggctttgggcctgaggaggggtctctccaggcattgttccag
cacggaggtgatgtgtcacgggccctgactgagctacagcgccaacgcctagagcccttc
cgccagcgcctctgggacagtggccctgagcccaccccttcctgggatgggccagacaag
cagagcctggtcaggcggcttttggcagtctacgcactccccagctggggccgggcagag
ctggcactgtcactgctgcaggagacacccaggaactatgagttgggggatgtggtagaa
gctgtgaggcacagccaggaccgggccttcctgcgccgcttgcttgcccaggagtgtgcc
gtgtgtggctgggccctgccccacaaccggatgcaggccctgacttcctgtgagtgcacc
atctgtcctgactgcttccgccagcacttcaccatcgccttgaaggagaagcacatcaca
gacatggtgtgccctgcctgtggccgccccgacctcaccgatgacacacagttgctcagc
tacttctctacccttgacatccagcttcgcgagagcctagagccagatgcctatgcgttg
ttccataagaagctgaccgagggtgtgctgatgcgggaccccaagttcttgtggtgtgcc
cagtgctcctttggcttcatatatgagcgtgagcagctggaggcaacttgtccccagtgt
caccagaccttctgtgtgcgctgcaagcgccagtgggaggagcagcaccgaggtcggagc
tgtgaggacttccagaactggaaacgcatgaacgacccagaataccaggcccagggccta
gcaatgtatcttcaggaaaacggcattgactgccccaaatgcaagttctcgtacgccctg
gcccgaggaggctgcatgcactttcactgtacccagtgccgccaccagttctgcagcggc
tgctacaatgccttttacgccaagaataaatgtccagagcctaactgcagggtgaaaaag
tccctgcacggccaccaccctcgagactgcctcttctacctgcgggactggactgctctc
cggcttcagaagctgctacaggacaataacgtcatgtttaatacagagcctccagctggg
gcccgggcagtccctggaggcggctgccgagtgatagagcagaaggaggttcccaatggg
ctcagggacgaagcttgtggcaaggaaactccagctggctatgccggcctgtgccaggca
cactacaaagagtatcttgtgagcctcatcaatgcccactcgctggacccagccaccttg
tatgaggtggaagagctggagacggccactgagcgctacctgcacgtacgcccccagcct
ttggctggagaggatccccctgcttaccaggcccgcttgttacagaagctgacagaagag
gtacccttgggacagagtatcccccgcaggcggaagtag

DBGET integrated database retrieval system