KEGG   Homo sapiens (human): 55362Help
Entry
55362             CDS       T01001                                 

Gene name
TMEM63B, C6orf110
Definition
(RefSeq) transmembrane protein 63B
  KO
K21989  calcium permeable stress-gated cation channel
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55362 (TMEM63B)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   55362 (TMEM63B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RSN1_7TM PHM7_cyt RSN1_TM
Motif
Other DBs
NCBI-GeneID: 55362
NCBI-ProteinID: NP_001305721
HGNC: 17735
Ensembl: ENSG00000137216
Vega: OTTHUMG00000014757
Pharos: Q5T3F8(Tdark)
UniProt: Q5T3F8
LinkDB All DBs
Position
6p21.1
AA seq 832 aa AA seqDB search
MLPFLLATLGTTALNNSNPKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFLALLFLFS
ILRKVAWDYGRLALVTDADRLRRQERDRVEQEYVASAMHGDSHDRYERLTSVSSSVDFDQ
RDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSG
DLLENNAYSFGRTTIANLKSGNNLLWLHTSFAFLYLLLTVYSMRRHTSKMRYKEDDLVKR
TLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTN
LQSKENVPTMINPKPCGHLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLG
MAFVTFHNETITAIILKDFNVCKCQGCTCRGEPRPSSCSESLHISNWTVSYAPDPQNIYW
EHLSIRGFIWWLRCLVINVVLFILLFFLTTPAIIITTMDKFNVTKPVEYLNNPIITQFFP
TLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLF
FRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCL
ARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLVDR
YNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFFSTMRTGFLAPTSMFTFVVLVIT
IVICLCHVCFGHFKYLSAHNYKIEHTETDTVDPRSNGRPPTAAAVPKSAKYIAQVLQDSE
VDGDGDGAPGSSGDEPPSSSSQDEELLMPPDALTDTDFQSCEDSLIENEIHQ
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctttctgctggccacactgggcaccacagccctcaacaacagcaaccccaag
gactactgctacagcgcccgcatccgcagcactgtcctgcagggcctgccctttgggggc
gtccccaccgtgctggctctcgacttcatgtgcttccttgcactgctgttcttattctct
atcctccggaaggtggcctgggactatgggcggctggccttggtgacagatgcagacagg
cttcggcggcaggagagggaccgagtggaacaggaatatgtggcttcagctatgcacggg
gacagccatgaccggtatgagcgtctcacctctgtctccagctccgttgactttgaccaa
agggacaatggtttctgttcctggctgacagccatcttcaggataaaggatgatgagatc
cgggacaaatgtgggggcgatgccgtgcactacctgtcctttcagcggcacatcatcggg
ctgctggtggttgtgggcgtcctctccgtaggcatcgtgctgcctgtcaacttctcaggg
gacctgctggagaacaatgcctacagctttgggagaaccaccattgccaacttgaaatca
gggaacaacctgctatggctgcacacctccttcgccttcctgtatctgctgctcaccgtc
tacagcatgcgtagacacacctccaagatgcgctacaaggaggatgatctggtgaagcgg
accctcttcatcaatggaatctccaaatatgcagagtcagaaaagatcaagaagcatttt
gaggaagcctaccccaactgcacagttctcgaagcccgcccgtgttacaacgtggctcgc
ctaatgttcctcgatgcagagaggaagaaggccgagcggggaaagctgtacttcacaaac
ctccagagcaaggagaacgtgcctaccatgatcaaccccaagccctgtggccacctctgc
tgctgtgtggtgcgaggctgtgagcaggtggaggccattgagtactacacaaagctggag
cagaagctgaaggaagactacaagcgggagaaggagaaggtgaatgagaagcctcttggc
atggcctttgtcaccttccacaatgagactatcaccgccatcatcctgaaggacttcaac
gtgtgtaaatgccagggctgcacctgccgtggggagccacgcccctcatcctgcagcgag
tccctgcacatctccaactggaccgtgtcctatgcccctgaccctcagaacatctactgg
gagcacctctccatccgaggcttcatctggtggctgcgctgcctggtcatcaatgtcgtc
ctcttcatcctcctcttcttcctcaccactccagccatcatcatcaccaccatggacaag
ttcaacgtcaccaagcctgtggagtacctcaacaaccccatcatcacccagttcttcccc
accctgctgctgtggtgcttctcggccctccttcccaccatcgtctactactcagccttc
tttgaagcccactggacacgctctggggagaacaggacaaccatgcacaagtgctacact
ttcctcatcttcatggtgctgctcctaccctcgctgggactgagcagcctggacctcttc
ttccgctggctctttgataagaaattcttggctgaggcagctattcggtttgagtgtgtg
ttcctgcccgacaacggcgccttcttcgtgaactacgtcattgcctcagcctttatcggc
aacgccatggacctgctgcgcatcccaggcctgctcatgtacatgatccggctctgcctg
gcgcgctcggccgccgagaggcgcaacgtgaagcggcatcaggcctacgagttccagttt
ggcgcagcctacgcctggatgatgtgcgtcttcacggtggtcatgacctacagtatcacc
tgccccatcatcgtgcccttcgggctcatgtacatgctgctgaagcacctggtagacagg
tacaatctctactacgcctacctgccggccaagctggacaagaagatccactcgggggct
gtgaaccaggtggtggccgcgcccatcctctgcctcttctggctgctcttcttttccacc
atgcgcacggggttcctagctcccacgtctatgttcacatttgtggtcctggtcatcacc
atcgtcatctgtctctgccacgtctgctttggacacttcaaatacctcagtgcccacaac
tacaagattgagcacacggagacagatactgtggaccccagaagcaatggacggcccccc
actgctgctgctgtccccaaatctgcgaaatacatcgctcaggtgctgcaggactcagag
gtggacggggatggggatggggctcctgggagctcaggggatgagcccccatcatcctca
tcccaagatgaggagttgctgatgccacccgacgccctcacggacacagacttccagtct
tgcgaggacagcctcatagagaatgagattcaccagtaa

DBGET integrated database retrieval system