KEGG   Homo sapiens (human): 5546
Entry
5546              CDS       T01001                                 

Gene name
PRCC, RCCP1, TPRC
Definition
(RefSeq) proline rich mitotic checkpoint control factor
  KO
K13105  proline-rich protein PRCC
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5546 (PRCC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    5546 (PRCC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    5546 (PRCC)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    5546 (PRCC)
SSDB
Motif
Pfam: PRCC
Other DBs
NCBI-GeneID: 5546
NCBI-ProteinID: NP_005964
OMIM: 179755
HGNC: 9343
Ensembl: ENSG00000143294
Vega: OTTHUMG00000041294
Pharos: Q92733(Tbio)
UniProt: Q92733 Q96FT4 A0A0S2Z456
LinkDB
Position
1q23.1
AA seq 491 aa
MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAP
AFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGL
NLPPPIGGAGPPLGLPKPKKRKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDGSPDTKPSRLASKTKTSSLAPVVGTTTTTP
SPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLPEKAEPPGVEPYPYPIPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAQDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKL
SRRQTQAKYGF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtcgctggttgcttacgccagcagcgatgagagcgagccggatgaggctgagcccgag
ccggaggaagaggaggcggtggctcctacatctgggcccgctttagggggcttgttcgct
tctctccctgcgcccaagggtccggccttgctgcctccgccccctcagatgctggcgcca
gcctttcccccgccgctgttgcttcccccacccaccggagaccccaggcttcagcctcct
ccccccttgcccttcggcctgggaggcttccccccacctccaggcgtgagcccggctgaa
gcggcgggagttggggagggactgggattggggttgccctcgccccgaggccctggcctc
aatctgccccctccaattggcggtgccggtcccccgctggggcttcccaagccaaagaag
aggaaagagcccgtgaagatcgcggcgccggagttgcataagggagattcagattctgag
gaagatgaacccacaaagaagaaaactatccttcagggatccagtgaggggactggtttg
tctgccttgcttccccaacctaaaaacctgactgtgaaagagactaacaggttgctcctg
ccccatgccttctcccgcaaaccctcggatggctcccctgatactaagccctccagactg
gcttctaagaccaagacttcctctcttgcccctgttgtgggcaccacaaccaccactccg
tcgccctctgctatcaaggctgctgccaagagtgctgccctgcaggtgacaaagcagatc
acgcaggaagaagacgacagtgatgaggaagtagcccccgaaaactttttctccctccct
gaaaaggctgagccacctggagttgagccatacccttaccccatccccactgtccctgaa
gagctgcctccaggcacggaaccagagccggctttccaggacgatgcagccaatgccccc
cttgaattcaagatggcagcaggttcaagtggggccccttggatgcctaagcctggggac
gactacagctacaatcagttttccacatatggcgatgccaatgccgctggtgcttattat
caggattattacagtggtggctactatcctgcacaggacccggccctggtccccccccag
gaaattgccccagatgcctccttcatcgatgacgaagcatttaagcggctgcagggcaag
aggaaccgagggagagaagaaatcaactttgtggagatcaaaggtgatgaccagctcagt
ggggcccagcaatggatgactaagtcattgacagaagagaaaaccatgaagtcattcagc
aaaaagaaaggtgagcagccaacaggccagcagcggcggaaacaccagatcacatatctt
attcatcaggccaaggagcgggagctggaactgaagaacacctggtcagagaacaagctc
agccgccgtcagacccaagccaaatatggattctag

DBGET integrated database retrieval system