KEGG   Homo sapiens (human): 5827
Entry
5827              CDS       T01001                                 

Gene name
PXMP2, MPV17L3, PMP22
Definition
(RefSeq) peroxisomal membrane protein 2
  KO
K13347  peroxisomal membrane protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H01155  Roussy-Levy syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5827 (PXMP2)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 5827
NCBI-ProteinID: NP_061133
OMIM: 617399
HGNC: 9716
Ensembl: ENSG00000176894
Vega: OTTHUMG00000168019
Pharos: Q9NR77(Tdark)
UniProt: Q9NR77
LinkDB
Position
12q24.33
AA seq 195 aa
MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRK
KENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPA
FLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFAN
LAALFWYAYLASLGK
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcgccggccgcgtccaggctgcgggccgaagccgggctcggggcgctgccgcggcgg
gcgctcgcccagtacctgctcttcctgcggctctacccggtgctcaccaaggcggccacc
agtggcattttgtcagcacttgggaacttcctggcccagatgattgagaagaagcggaaa
aaagaaaactctagaagtctggatgtcggtgggcctctgagatatgccgtttacgggttc
ttcttcacagggccgctgagtcacttcttctacttcttcatggaacattggatccctcct
gaggtccccctggcagggctcaggaggcttctcctggaccgcctcgtctttgcaccggcc
ttcctcatgttgttcttcctcatcatgaactttctggaggggaaagacgcctcagccttc
gccgccaagatgagggggggcttctggccggcgctgaggatgaactggcgggtgtggacg
ccactacagttcatcaacatcaactacgtccctctgaagttccgggtgctcttcgccaac
ctggcagctctgttctggtatgcctacctggcctccttggggaagtga

DBGET integrated database retrieval system