KEGG   Homo sapiens (human): 5872
Entry
5872              CDS       T01001                                 

Gene name
RAB13, GIG4
Definition
(RefSeq) RAB13, member RAS oncogene family
  KO
K06109  Ras-related protein Rab-13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5872 (RAB13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5872 (RAB13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5872 (RAB13)
   04031 GTP-binding proteins [BR:hsa04031]
    5872 (RAB13)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    5872 (RAB13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5872 (RAB13)
  Exosomal proteins of colorectal cancer cells
   5872 (RAB13)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    5872 (RAB13)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB RsgA_GTPase MMR_HSR1 PduV-EutP AAA_7 Septin AAA AAA_22 TniB FeoB_N AAA_16 AAA_5
Other DBs
NCBI-GeneID: 5872
NCBI-ProteinID: NP_002861
OMIM: 602672
HGNC: 9762
Ensembl: ENSG00000143545
Vega: OTTHUMG00000036589
Pharos: P51153(Tbio)
UniProt: P51153 Q504R6
LinkDB
Position
1q21.3
AA seq 203 aa
MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ
VWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLG
NKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGN
GNKPPSTDLKTCDKKNTNKCSLG
NT seq 612 nt   +upstreamnt  +downstreamnt
atggccaaagcctacgaccacctcttcaagttgctgctgatcggggactcgggggtgggc
aagacttgtctgatcattcgctttgcagaggacaacttcaacaacacttacatctccacc
atcggaattgatttcaagatccgcactgtggatatagaggggaagaagatcaaactacaa
gtctgggacacggctggccaagagcggttcaagacaataactactgcctactaccgtgga
gccatgggcattatcctagtatacgacatcacggatgagaaatctttcgagaatattcag
aactggatgaaaagcatcaaggagaatgcctcggctggggtggagcgcctcttgctgggg
aacaaatgtgacatggaggccaagaggaaggtgcagaaggagcaggccgataagttggct
cgagagcatggaatccgatttttcgaaactagtgctaaatccagtatgaatgtggatgag
gcttttagttccctggcccgggacatcttgctcaagtcaggaggccggagatcaggaaac
ggcaacaagcctcccagtactgacctgaaaacttgtgacaagaagaacaccaacaagtgc
tccctgggctga

DBGET integrated database retrieval system