KEGG   Homo sapiens (human): 5993
Entry
5993              CDS       T01001                                 

Gene name
RFX5
Definition
(RefSeq) regulatory factor X5
  KO
K08061  regulatory factor X 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiency
H00985  Bare lymphocyte syndrome type2
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    5993 (RFX5)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    5993 (RFX5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    5993 (RFX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5993 (RFX5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other basic domains
   RF-X
    5993 (RFX5)
SSDB
Motif
Pfam: RFX5_DNA_bdg RFX5_N RFX_DNA_binding Pox_D5
Other DBs
NCBI-GeneID: 5993
NCBI-ProteinID: NP_000440
OMIM: 601863
HGNC: 9986
Ensembl: ENSG00000143390
Vega: OTTHUMG00000012495
Pharos: P48382(Tbio)
UniProt: P48382
LinkDB
Structure
PDB: 
2KW3

Position
1q21.3
AA seq 616 aa
MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDND
KLYLYLQLPSGPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKY
CESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDL
KGSESPEMGPEVTPAPRDELVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARS
AHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKKPERLAQPPKDLEARTGAGPL
ARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPILAPRLSSGAL
KVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG
GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERN
STPLKSAAAMESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVS
KGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVL
QSSLSQEHKDPKATPP
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggcagaagatgagcctgatgctaagagccccaagactgggggaagggcccccccaggt
ggtgctgaggctggggaacctaccacccttcttcagaggctccgaggtaccatttccaag
gccgtgcagaacaaagtagaggggatcctgcaagatgtacagaaattttctgacaatgac
aagctgtatctctaccttcagctcccctcaggacccaccactggagacaaaagctcagag
ccaagtacactgagcaatgaggagtacatgtatgcctataggtggatccgcaaccacctg
gaagagcacactgacacctgtctgccaaagcaaagtgtttatgatgcctatcggaagtac
tgtgagagtcttgcctgttgccgcccactcagcacagccaactttggcaagatcatcaga
gagatcttccctgacatcaaagctcgaaggcttggtggccggggccagtccaaatattgc
tacagtggcataaggaggaagaccttggtgtctatgccacccctgcctggacttgaccta
aagggttctgagagtccagaaatgggcccagaagtaaccccagcacctcgagatgaactg
gtggaggcagcgtgtgccctgacctgtgactgggcagagcggatcctgaaacggtccttc
agttccatcgttgaggtcgcccgcttcctgctacagcagcatctcatctctgcccgatct
gcacatgcccatgtgcttaaggccatggggctcgctgaagaggacgaacatgcacctcgg
gaacggtcatctaaaccaaagaatggtttagagaacccagagggtggagcccacaagaag
ccagagagactggcccagcctcctaaggatctggaagcccgaactggggccggtcctctc
gcacgtggagagcggaagaagagtgtagttgagagctcggccccaggagccaataacctg
caggttaatgccctagtggctcggctgcctctgctccttccccgggcccctcgctcacta
attccgccaatcccagtctctccacctattctggcccccaggctttcttcaggtgccctg
aaagtggctacactgcctctgtctagtagggccggggcacccccagcagctgtgcccatc
attaacatgatcttaccaactgttcctgctttgcctggacctggacctgggcctgggcga
gctccacctgggggactcactcagccccggggcacagagaacagagaggtaggcataggt
ggtgaccaaggaccacatgacaagggtgtcaagaggacagctgaagtacctgtgagtgag
gccagtgggcaggctccaccagctaaagcagcaaagcaggatatagaggatacagcaagt
gatgccaaaaggaaacgggggcgccctcgaaaaaagtcaggtggaagtggggaaaggaat
tctacccctctcaagtcagcagctgccatggaatctgcccagtcctcaaggttaccatgg
gagacatggggctcaggaggggaaggcaactcagctggaggggcagagaggccagggcca
atgggagaggctgaaaagggggcagtacttgcccagggtcagggagatggtactgtttcc
aaaggaggaaggggccccggttcccagcataccaaagaagcagaagataaaattcccttg
gtcccctcaaaagtgagtgtcatcaagggcagcagaagccaaaaggaggcttttcctttg
gcaaagggagaggtagacactgcaccacagggtaataaagacttaaaggagcatgtgctt
caaagttccttatcccaggagcataaagacccaaaagcaacacccccatga

DBGET integrated database retrieval system