KEGG   Homo sapiens (human): 5997Help
Entry
5997              CDS       T01001                                 

Gene name
RGS2, G0S8
Definition
(RefSeq) regulator of G protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04740  Olfactory transduction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    5997 (RGS2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    5997 (RGS2)
  09157 Sensory system
   04740 Olfactory transduction
    5997 (RGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS COMPASS-Shg1
Motif
Other DBs
NCBI-GeneID: 5997
NCBI-ProteinID: NP_002914
OMIM: 600861
HGNC: 9998
Ensembl: ENSG00000116741
Vega: OTTHUMG00000035600
Pharos: P41220(Tbio)
UniProt: P41220 A0A024R939
LinkDB All DBs
Structure
PDB: 

Position
1q31.2
AA seq 211 aa AA seqDB search
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgctatgttcttggctgttcaacacgactgcagacccatggacaagagcgca
ggcagtggccacaagagcgaggagaagcgagaaaagatgaaacggacccttttaaaagat
tggaagacccgtttgagctacttcttacaaaattcctctactcctgggaagcccaaaacc
ggcaaaaaaagcaaacagcaagctttcatcaagccttctcctgaggaagcacagctgtgg
tcagaagcatttgacgagctgctagccagcaaatatggtcttgctgcattcagggctttt
ttaaagtcggaattctgtgaagaaaatattgaattctggctggcctgtgaagacttcaaa
aaaaccaaatcaccccaaaagctgtcctcaaaagcaaggaaaatatatactgacttcata
gaaaaggaagctccaaaagagataaacatagattttcaaaccaaaactctgattgcccag
aatatacaagaagctacaagtggctgctttacaactgcccagaaaagggtatacagcttg
atggagaacaactcttatcctcgtttcttggagtcagaattctaccaggacttgtgtaaa
aagccacaaatcaccacagagcctcatgctacatga

DBGET integrated database retrieval system