KEGG   Homo sapiens (human): 5997
Entry
5997              CDS       T01001                                 

Gene name
RGS2, G0S8
Definition
(RefSeq) regulator of G protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04740  Olfactory transduction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    5997 (RGS2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    5997 (RGS2)
  09157 Sensory system
   04740 Olfactory transduction
    5997 (RGS2)
SSDB
Motif
Pfam: RGS COMPASS-Shg1
Other DBs
NCBI-GeneID: 5997
NCBI-ProteinID: NP_002914
OMIM: 600861
HGNC: 9998
Ensembl: ENSG00000116741
Vega: OTTHUMG00000035600
Pharos: P41220(Tbio)
UniProt: P41220 A0A024R939
LinkDB
Structure
PDB: 
2AF0 4EKD 2V4Z 4EKC

Position
1q31.2
AA seq 211 aa
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaaagtgctatgttcttggctgttcaacacgactgcagacccatggacaagagcgca
ggcagtggccacaagagcgaggagaagcgagaaaagatgaaacggacccttttaaaagat
tggaagacccgtttgagctacttcttacaaaattcctctactcctgggaagcccaaaacc
ggcaaaaaaagcaaacagcaagctttcatcaagccttctcctgaggaagcacagctgtgg
tcagaagcatttgacgagctgctagccagcaaatatggtcttgctgcattcagggctttt
ttaaagtcggaattctgtgaagaaaatattgaattctggctggcctgtgaagacttcaaa
aaaaccaaatcaccccaaaagctgtcctcaaaagcaaggaaaatatatactgacttcata
gaaaaggaagctccaaaagagataaacatagattttcaaaccaaaactctgattgcccag
aatatacaagaagctacaagtggctgctttacaactgcccagaaaagggtatacagcttg
atggagaacaactcttatcctcgtttcttggagtcagaattctaccaggacttgtgtaaa
aagccacaaatcaccacagagcctcatgctacatga

DBGET integrated database retrieval system