KEGG   Homo sapiens (human): 60401Help
Entry
60401             CDS       T01001                                 

Gene name
EDA2R, EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Definition
(RefSeq) ectodysplasin A2 receptor
  KO
K05163  tumor necrosis factor receptor superfamily member 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    60401 (EDA2R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60401 (EDA2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    60401 (EDA2R)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   60401 (EDA2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 60401
NCBI-ProteinID: NP_001186616
OMIM: 300276
HGNC: 17756
Ensembl: ENSG00000131080
Vega: OTTHUMG00000021736
Pharos: Q9HAV5(Tbio)
UniProt: Q9HAV5 B2RBZ9
LinkDB All DBs
Position
Xq12
AA seq 297 aa AA seqDB search
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQS
CITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAF
QLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEA
DKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCT
SESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggattgccaagaaaatgagtactgggaccaatggggacggtgtgtcacctgccaacgg
tgtggtcctggacaggagctatccaaggattgtggttatggagagggtggagatgcctac
tgcacagcctgccctcctcgcaggtacaaaagcagctggggccaccacagatgtcagagt
tgcatcacctgtgctgtcatcaatcgtgttcagaaggtcaactgcacagctacctctaat
gctgtctgtggggactgtttgcccaggttctaccgaaagacacgcattggaggcctgcag
gaccaagagtgcatcccgtgcacgaagcagacccccacctctgaggttcaatgtgccttc
cagttgagcttagtggaggcagatgcacccacagtgccccctcaggaggccacacttgtt
gcactggtgagcagcctgctagtggtgtttaccctggccttcctggggctcttcttcctc
tactgcaagcagttcttcaacagacattgccagcgtggaggtttgctgcagtttgaggct
gataaaacagcaaaggaggaatctctcttccccgtgccacccagcaaggagaccagtgct
gagtcccaagtgagtgagaacatctttcagacccagccacttaaccctatcctcgaggac
gactgcagctcgactagtggcttccccacacaggagtcctttaccatggcctcctgcacc
tcagagagccactcccactgggtccacagccccatcgaatgcacagagctggacctgcaa
aagttttccagctctgcctcctatactggagctgagaccttggggggaaacacagtcgaa
agcactggagacaggctggagctcaatgtgccctttgaagttcccagcccttaa

DBGET integrated database retrieval system